KEGG   Escherichia coli NA114 (UPEC): ECNA114_2882
Entry
ECNA114_2882      CDS       T01998                                 

Gene name
ygdB
Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: DUF2509 Fungal_trans
Other DBs
NCBI-ProteinID: AEG37719
Position
complement(2959820..2960227)
AA seq 135 aa
MNREKGVSSLALVLMLLILGSLLLQGMSQQDRSFASRVSMESQSLRRQAIVQSALEWGKM
HSWQTLPAVQCLLYAATGARVCLRLLADNEALLIAGYEGVSLWRTGEVIDGNIVFSPRGW
SDFCPLKERALCQLP
NT seq 408 nt   +upstreamnt  +downstreamnt
gtgaaccgcgaaaagggtgtttcgtcactggctctggtcctgatgctgctgattttgggt
agcttgctattgcaaggaatgagtcagcaggatcgcagttttgcttctcgcgtgagcatg
gaaagtcagtcattgcgccgccaggccatcgttcagtcggcgctggagtggggaaaaatg
cactcctggcagacgctgcccgcagttcagtgcttactgtatgctgccaccggtgcccgg
gtttgtctgcgtttactggcagataatgaagccttattgattgctggttatgaaggcgtt
tcgttgtggcgaacaggcgaagtcatcgatggaaacattgttttttcgccacgcggctgg
agcgatttttgtccgctgaaagagagggcgttatgtcagcttccctga

DBGET integrated database retrieval system