KEGG   Escherichia coli NA114 (UPEC): ECNA114_2883
Entry
ECNA114_2883      CDS       T01998                                 

Gene name
ppdB
Definition
(GenBank) B precursor of Prepilin peptidase dependent protein
  KO
K02680  prepilin peptidase dependent protein B
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2883 (ppdB)
Secretion system [BR:ena02044]
 Type II secretion system
  Type IVa pilus homolog protein
   ECNA114_2883 (ppdB)
SSDB
Motif
Pfam: N_methyl
Other DBs
NCBI-ProteinID: AEG37720
Position
complement(2960224..2960787)
AA seq 187 aa
MPVKEQGFSLLEVLIAMAISSVLLLGAARFLPALQRESLTNTRKLALEDEIWLRVFTVAK
HLQRAGYCHGSCTGEGLEIVGQGDCVIVQWDANSNGIWDREPVKESDQIGFRLKEHVLET
LRGATSCEGKGWDKVTNPDAIIIDTFQVVRQDVSGFSPVLTVNMHAASKADPQTVVDASY
SVTGSNL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcctgtaaaagagcaaggtttttctctgctggaagtgttgattgctatggcgatcagt
agcgtattgttgctgggggctgcacgctttctgcctgcgttacagcgtgaaagtttaacg
aacacccgtaagctggcgctggaagatgaaatctggctgcgggtatttaccgtcgcgaag
catctccagagggcgggttattgccatggcagctgtacgggcgaagggctggaaattgtc
ggacagggtgactgtgtcattgtgcagtgggatgcgaacagtaatggtatctgggatcgc
gaaccggtaaaagagtccgaccagattggatttcgtctgaaggagcatgtgctggaaacg
ctacgcggtgcgacatcctgtgaaggtaagggctgggataaagtcactaatccggatgcc
atcattatcgacacttttcaggtcgtacgtcaggatgtcagcggcttctcgccggtgttg
acggttaatatgcacgctgccagcaaggctgatccgcaaaccgtggtggatgccagctat
agcgtgacaggatccaacctgtga

DBGET integrated database retrieval system