KEGG   Escherichia coli NA114 (UPEC): ECNA114_2884
Entry
ECNA114_2884      CDS       T01998                                 

Gene name
ppdA
Definition
(GenBank) A precursor of Prepilin peptidase dependent protein
  KO
K02679  prepilin peptidase dependent protein A
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2884 (ppdA)
Secretion system [BR:ena02044]
 Type II secretion system
  Type IVa pilus homolog protein
   ECNA114_2884 (ppdA)
SSDB
Motif
Pfam: N_methyl GspL_C TPR_21
Other DBs
NCBI-ProteinID: AEG37721
Position
complement(2960778..2961248)
AA seq 156 aa
MKKQRGYTLIETLVAMLILVMLSASGLYGWQYWQQSQRLWQTASQARDYLLYLREDANWH
NRDHSISLIREGTLWCLVSSVAGANTCHGSSPLVFVPRWPEVEMSDLTPSLAFFGLRNTA
WAGHIRFKNSTGEWWLVVSPWGRLRLCQQGETEGCL
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaaaaaacaacgtggttatacgctgattgaaacgctggtcgcgatgctgattctggtc
atgctaagcgcaagtgggctctatggctggcaatactggcagcagtcgcaacggctttgg
caaaccgccagccaggcgcgggactatttgctctatttacgtgaagatgccaactggcat
aaccgcgaccacagtatcagtcttatcagggaggggacgttatggtgccttgtgagttcc
gttgctggggcgaatacctgtcatggcagttcaccattggtctttgtgccgcgctggccc
gaagtcgaaatgagcgacctgacaccttcgcttgctttctttggcctgcgcaataccgca
tgggccgggcatattcgcttcaaaaactcaacgggcgagtggtggctagtggtttcgccg
tggggaagactccggctttgtcagcaaggagaaacagaaggatgcctgtaa

DBGET integrated database retrieval system