KEGG   Escherichia coli NA114 (UPEC): ECNA114_2885
Entry
ECNA114_2885      CDS       T01998                                 

Gene name
thyA
Definition
(GenBank) Thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00240  Pyrimidine metabolism
ena00670  One carbon pool by folate
ena01100  Metabolic pathways
Module
ena_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECNA114_2885 (thyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ECNA114_2885 (thyA)
Enzymes [BR:ena01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     ECNA114_2885 (thyA)
SSDB
Motif
Pfam: Thymidylat_synt
Other DBs
NCBI-ProteinID: AEG37722
Structure
PDB: 

Position
complement(2961433..2962227)
AA seq 264 aa
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF
DYRFEDFEIEGYDPHPGIKAPVAI
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaaacagtatttagaactgatgcaaaaagtgctcgacgaaggcacacagaaaaacgac
cgtaccggaaccggaacgctttccatttttggtcatcagatgcgttttaacctgcaggat
ggattcccgctggtgacaactaaacgttgccacctgcgttccatcatccacgaactgctg
tggttcctgcagggcgacactaacattgcttatctacacgaaaacaatgtcaccatctgg
gacgaatgggccgatgaaaacggcgacctcgggccagtgtatggtaaacagtggcgcgcc
tggccaacgccggatggtcgtcatattgaccagatcactacggtactgaaccagctgaaa
aacgacccggattcccgtcgcattattgtttcagcgtggaacgtaggcgaactggataaa
atggcgctggcaccgtgccatgcattcttccagttctatgtggcagacggcaaactctct
tgccagctttatcagcgctcctgtgacgtcttcctcggcctgccgttcaacattgccagc
tacgcgttactggtgcatatgatggcgcagcagtgcgatctggaagtgggtgattttgtc
tggaccggtggcgacacgcatctgtacagcaaccatatggatcaaactcatctgcaatta
agccgcgaaccgcgtccgctgccgaagttgattatcaaacgtaaacccgaatccatcttc
gactaccgtttcgaagactttgagattgaaggatacgatccacatccgggcattaaagcg
ccggtggctatctaa

DBGET integrated database retrieval system