KEGG   Escherichia coli NA114 (UPEC): ECNA114_2886
Entry
ECNA114_2886      CDS       T01998                                 

Gene name
lgt
Definition
(GenBank) Prolipoprotein diacylglyceryl transferase
  KO
K13292  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase [EC:2.5.1.145]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECNA114_2886 (lgt)
Enzymes [BR:ena01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.145  phosphatidylglycerol---prolipoprotein diacylglyceryl transferase
     ECNA114_2886 (lgt)
SSDB
Motif
Pfam: LGT
Other DBs
NCBI-ProteinID: AEG37723
Structure
PDB: 
5AZB 5AZC

Position
complement(2962234..2963109)
AA seq 291 aa
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL
LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT
KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN
PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI
IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaccagtagctatctgcattttccggagtttgatccggtcattttctcaataggaccc
gtggcgcttcactggtacggactgatgtatctggtgggtttcatttttgcaatgtggctg
gcaacacgacgggcgaatcgtccgggcagtggctggaccaaaaatgaagttgaaaactta
ctctatgcgggcttcctcggcgtcttcctcggtggacgtattggttatgttctgttctac
aatttcccgcagtttatggccgatccgctgtatcttttccgtgtctgggacggcggcatg
tccttccacggcggcctgattggcgttatcgtggtgatgattatcttcgcccgccgtact
aaacgttccttcttccaggtctctgattttattgctccactcattccgtttggtcttggt
gccgggcgtctgggcaactttattaacggtgaattgtggggccgcgttgacccgaacttc
ccgtttgccatgctgttccctggctcccgtacagaagatattttgctgctgcaaaccaac
ccgcagtggcaatccattttcgacacttacggtgtgctgccgcgccacccatcacagctt
tacgagctgctgctggaaggtgtggtgctgtttattatcctcaacctgtatattcgtaaa
ccgcgcccaatgggagctgtctcaggcttgttcctgattggttacggagcgtttcgcatc
attgttgagtttttccgccagcccgacgcgcagtttactggtgcctgggtgcagtacatc
agcatggggcaaattctttccatcccgatgattgtcgcgggtgtgatcatgatggtctgg
gcatatcgtcgcagcccacagcaacacgtttcctga

DBGET integrated database retrieval system