KEGG   Escherichia coli NA114 (UPEC): ECNA114_2887
Entry
ECNA114_2887      CDS       T01998                                 

Gene name
ptsP
Definition
(GenBank) Phosphoenolpyrutvate-protein phosphotransferase
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECNA114_2887 (ptsP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2887 (ptsP)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     ECNA114_2887 (ptsP)
Transporters [BR:ena02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    ECNA114_2887 (ptsP)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers GAF GAF_2 GAF_3
Other DBs
NCBI-ProteinID: AEG37724
Structure
PDB: 
5T12 5T1O

Position
complement(2963260..2965506)
AA seq 748 aa
MLTRLREIVEKVASAPRLNEALNILVTDICLAMDTEVCSVYLADHDRRCYYLMATRGLKK
PRGRTVTLAFDEGIVGLVGRLAEPINLADAQKHPSFKYIPSVKEERFRAFLGVPIIQRRQ
LLGVLVVQQRELRQYDESEESFLVTLATQMAAILSQSQLTALFGQYRQTRIRALPAAPGV
AIAEGWQDATLPLMEQVYQASTLDPALERERLTGALEEAANEFRRYSKRFAAGAQKETAA
IFDLYSHLLSDTRLRRELFAEVDKGSVAEWAVKTVIEKFAEQFAALSDNYLKERAGDLRA
LGQRLLFHLDDANQGPNAWPERFILVADELSATTLAELPQDRLVGVVVRDGAANSHAAIM
VRALGIPTVMGADIQPSVLHRRTLIVDGYRGELLVDPEPVLLQEYQRLISEEIELSRLAE
DDVNLPAQLKSGERIKVMLNAGLSPEHEEKLGSRIDGIGLYRTEIPFMLQSGFPSEEEQV
AQYQGMLQMFNDKPVTLRTLDVGADKQLPYMPISEENPCLGWRGIRITLDQPEIFLIQVR
AMLRANAATGNLNILLPMVTSLDEVDEARRLIERAGREVEEMIGYEIPKPRIGIMLEVPS
MVFMLPHLAKRVDFISVGTNDLTQYILAVDRNNTRVANIYDSLHPAMLRALAMIAREAEI
HGIDLRLCGEMAGDPMCVAILIGLGYRHLSMNGRSVARVKYLLRRIDFAEAENLAQRSLE
AQLATEVRHQVAAFMERRGMGGLIRGGL
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgctcactcgcctgcgcgaaatagtcgaaaaggtagccagcgcaccacgcctgaatgag
gcgttaaatattctggttaccgacatctgtcttgcgatggataccgaggtctgttcggtc
tacctggccgatcatgatcgacgttgttactacctgatggcgacccggggactgaaaaaa
ccacgcggtcgcactgtaacgctcgcgtttgatgaagggatcgtcggcctggttggcagg
ctggcggaaccgataaaccttgcagatgcgcaaaagcaccccagcttcaaatacatcccc
tccgtaaaagaagaacgtttccgcgcgtttttaggcgtaccaattattcaacgtcgccag
ttgcttggtgtactggtggtacagcaacgagagttgcgccagtatgacgaaagtgaagaa
tccttcctggtgacgcttgccacccagatggcagctattctttctcagtcgcagttgact
gccttgtttgggcaatatcgccagacgcgaatccgtgcattaccggcagcacctggtgtg
gcgattgccgaaggctggcaggatgccacgttacctttaatggaacaggtgtatcaggca
tcaacgctggatccggctctggaacgcgaacgactgaccggggcgttggaagaggcggct
aacgagtttcgccgctatagcaaacgctttgctgccggtgcacaaaaagaaacggcggct
attttcgatctttactcacacctgctttcggatacccggctgcgtcgcgaattgtttgcc
gaggttgataaaggctcggtggcagagtgggcggtaaaaacggtcattgaaaaatttgcc
gaacagtttgccgcgctaagcgataactatctcaaagagcgggctggcgatttacgtgca
cttggtcagcgattgctgtttcatcttgatgacgctaatcaagggccgaacgcctggccg
gaacgtttcattctggtggcagatgaactgtcagcgacaacgcttgctgagctgccccag
gatcgcttagtcggtgttgtcgtgcgcgatggcgctgccaactcccatgctgcgatcatg
gtacgtgcgctggggatccctaccgtgatgggcgcggatattcagccttcggtactgcat
cgtcggacgctgatcgtcgatggttatcgcggtgaattgctggtcgatccggagccggta
ctgctgcaagaatatcagcggctaattagtgaagagatcgagcttagccgtctggcggaa
gatgacgtcaatttacccgcccagttaaaaagcggcgaacgcattaaagtcatgctcaat
gccggtttaagcccggaacatgaagaaaaactgggcagccgtattgatggcataggactt
tatcgcactgaaatcccattcatgctgcaaagtggttttccgtcggaagaagaacaggtg
gcgcagtatcaggggatgctgcaaatgtttaatgataaacccgtcaccttgcgtacgctg
gatgtcggagcagataagcagctgccttacatgccgatcagcgaagagaatccatgcctg
ggttggcgtgggattcgcattacgctcgatcagccggagatcttcttgatccaggtgcgg
gcgatgctgcgtgctaatgccgctacgggcaacctgaatattctgttgccgatggtcaca
agcctcgatgaagttgacgaagcacgccgcctgattgaacgtgccggacgtgaagtcgag
gagatgatcggttacgaaattcccaaaccacgtatcggcatcatgctggaagtgccgtca
atggtgtttatgctgccgcatctggcaaagcgggtcgatttcatctctgttggcaccaac
gatctgacgcaatacatcctggccgttgatcgcaacaatacccgggtggcgaacatttat
gacagtcttcatcctgcaatgttacgagctctggcgatgatcgcccgggaagcggaaata
catggaatcgatctccgtttgtgcggtgaaatggcgggcgatccgatgtgcgtggcaatc
ctcattgggcttgggtatcgccatctgtctatgaacggacgttctgtagcgcgcgtaaaa
tacctgctgcggcgcattgattttgccgaagcagaaaatcttgcgcagcgtagtctggaa
gcgcaactggcgaccgaagttcgccatcaggttgcagcctttatggagcgtcgcggcatg
ggcgggctgattcgtggggggttatag

DBGET integrated database retrieval system