KEGG   Escherichia coli NA114 (UPEC): ECNA114_2888
Entry
ECNA114_2888      CDS       T01998                                 

Gene name
ygdP
Definition
(GenBank) Dinucleoside polyphosphate hydrolase
  KO
K08311  putative (di)nucleoside polyphosphate hydrolase [EC:3.6.1.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ena00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ECNA114_2888 (ygdP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ena03019]
    ECNA114_2888 (ygdP)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     ECNA114_2888 (ygdP)
Messenger RNA biogenesis [BR:ena03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     ECNA114_2888 (ygdP)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-ProteinID: AEG37725
Structure
PDB: 

Position
complement(2965519..2966049)
AA seq 176 aa
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGL
SRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPE
FDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG
NT seq 531 nt   +upstreamnt  +downstreamnt
gtgattgatgacgatggctaccgcccaaacgtaggtatcgtgatttgtaatcgccagggg
caggtaatgtgggcccggcgatttggtcagcactcctggcaatttccgcaaggcggaatc
aaccccggagaatccgcagagcaggcgatgtaccgtgaattgtttgaagaagtaggatta
agccgcaaagacgttcgaatccttgcttcaacgcgtaactggttgcgctacaaattaccg
aaacgtttggtgcgttgggacacgaagccggtttgtatcggccaaaaacaaaaatggttt
ctcttgcagctggtgagcggcgatgcagaaatcaatatgcaaaccagcagtacaccagag
tttgacggctggcgatgggtaagttactggtatccagtcagacaggtggtgtcatttaaa
cgtgatgtctaccgtagggtaatgaaagagttcgcgagtgtggtgatgtcactgcaggaa
aatacgccaaaaccacaaaacgcatctgcttatcgacgtaaaagaggttaa

DBGET integrated database retrieval system