KEGG   Escherichia coli NA114 (UPEC): ECNA114_2889
Entry
ECNA114_2889      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Other DBs
NCBI-ProteinID: AEG37726
Position
complement(2966402..2966548)
AA seq 48 aa
MLSTESWDNCEKPSLLFPFTALTCDETPVFSGSVLNLVAHSVDKYGVG
NT seq 147 nt   +upstreamnt  +downstreamnt
atgttatccacagaaagctgggataactgtgaaaaaccttcactactgtttccatttaca
gccttgacgtgcgacgaaactccagtttttagtggttcagtgcttaacttagtggcacat
tctgtggataaatacggcgttggttga

DBGET integrated database retrieval system