KEGG   Escherichia coli NA114 (UPEC): ECNA114_2891
Entry
ECNA114_2891      CDS       T01998                                 

Gene name
mutH
Definition
(GenBank) DNA mismatch repair endonuclease
  KO
K03573  DNA mismatch repair protein MutH
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ena00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    ECNA114_2891 (mutH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ena03400]
    ECNA114_2891 (mutH)
DNA repair and recombination proteins [BR:ena03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Strand discrimination factor
     ECNA114_2891 (mutH)
SSDB
Motif
Pfam: MutH
Other DBs
NCBI-ProteinID: AEG37728
Structure
PDB: 
1AZO 2AZO

Position
2966734..2967423
AA seq 229 aa
MSQPRPLLSPPETEEQLLAQAQQLSGYTLGELAALAGLVTPENLKRDKGWIGVLLEIWLG
ASAGSKPEQDFAALGVELKTIPVDSLGRPLETTFVCVAPLTGNSGVTWETSHVRHKLKRV
LWIPVEGERSIPLAKRRVGSPLLWSPNEEEDRQLREDWEELMDMIVLGQIERITARHGEY
LQIRPKAANAKALTEAIGARGERILTLPRGFYLKKNFTSALLARHFLIQ
NT seq 690 nt   +upstreamnt  +downstreamnt
atgtcccaacctcgcccactgctctctcctcccgaaactgaagaacaattgttagcgcaa
gcacaacaactttctggttatacattgggagaactggcggcacttgccgggctggttacg
ccggagaatttaaaacgcgataagggctggattggcgtgttactggagatctggctaggt
gccagcgcagggagtaaacctgagcaagattttgctgctctgggcgtggaacttaaaact
atccctgtggatagtcttggtcgtccgctggaaacaacattcgtttgtgttgccccgtta
acgggcaatagcggggtgacatgggaaaccagccacgtgcgccacaagctcaaacgcgtg
ctgtggataccggttgaaggcgagcgcagcatcccgctggcaaagcgtcgcgtaggatca
ccgttgctgtggagcccgaatgaagaggaagaccggcagctacgcgaagactgggaagaa
ttaatggatatgattgttctcggtcagattgagcggatcaccgctcgtcacggggaatat
ttacagatacgaccgaaagcagcgaatgcgaaagcgctgaccgaagctattggtgcccgg
ggcgaacggattctgacgctgccgcgcggattttatttgaagaagaatttcaccagtgcg
ctactggcccgtcattttctgatccagtag

DBGET integrated database retrieval system