KEGG   Escherichia coli NA114 (UPEC): ECNA114_2892
Entry
ECNA114_2892      CDS       T01998                                 

Definition
(GenBank) ygdQ protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: TerC
Other DBs
NCBI-ProteinID: AEG37729
Position
2967492..2968205
AA seq 237 aa
MLFAWITDPNAWLALGTLTLLEIVLGIDNIIFLSLVVAKLPTAQRAHARRLGLAGAMVMR
LALLASIAWVTRLTNPLFTIFSQEISARDLILLLGGLFLIWKASKEIHESIEGEEEGLKT
RVSSFLGAIVQIMLLDIIFSLDSVITAVGLSDHLFIMMAAVVIAVGVMMFAARSIGDFVE
RHPSVKMLALSFLILVGFTLILESFDIHVPKGYIYFAMFFSIAVESLNLIRNKKNPL
NT seq 714 nt   +upstreamnt  +downstreamnt
atgttatttgcatggataaccgatcctaacgcctggcttgcgctcggtacgctgacgctg
ctggagatcgttcttgggatcgacaatattattttcctttctctggtggtggcaaagctc
ccaacagcacaacgtgctcatgcgcgccgtctggggttggcgggagccatggtcatgcgt
ctggcgctgctggcatccatcgcctgggttacgcgcctgacgaatccgctttttacaata
ttcagtcaggaaatttccgcccgtgatttgattctgcttctgggtggcttgttccttatc
tggaaagccagcaaggaaatccacgaatccatcgaaggtgaagaagaagggctgaaaaca
cgcgtttcatcattcctcggcgctatcgtgcagattatgctgctggatattatcttcagc
ctcgactcggtgattaccgctgtgggtctgtcagatcacctgtttattatgatggctgcc
gtggtgattgccgtaggcgtgatgatgttcgccgcgcgctcgattggtgattttgtcgag
cgccatccttcggtaaaaatgctggcgctctctttcctgattctggtgggctttaccctg
attctggaaagtttcgacatccacgtaccgaaaggttacatctacttcgcgatgttcttc
tctattgcggttgaaagcctaaacctgattcgcaacaaaaagaatccgctctga

DBGET integrated database retrieval system