KEGG   Escherichia coli NA114 (UPEC): ECNA114_2893
Entry
ECNA114_2893      CDS       T01998                                 

Gene name
ygdR
Definition
(GenBank) putative lipoprotein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: DUF903 LPAM_1 CopK
Other DBs
NCBI-ProteinID: AEG37730
Structure
PDB: 
3FIF 2JN0

Position
2968343..2968561
AA seq 72 aa
MKKWAVIISAVGLAFAVSGCSSDYVMATKDGRMILTDGKPEIDDDTGLVSYHDQQGNAMQ
INRDDVSQIIER
NT seq 219 nt   +upstreamnt  +downstreamnt
atgaaaaaatgggcagtaataatttctgcagtcggactggcgtttgctgtttccgggtgt
tccagtgattacgtcatggcgaccaaagatggccgtatgattttgaccgatggaaaacct
gaaattgatgatgataccgggctggtgagttatcacgatcagcaaggtaacgcgatgcaa
attaaccgtgatgatgtttcgcaaattattgaacgttaa

DBGET integrated database retrieval system