KEGG   Escherichia coli NA114 (UPEC): ECNA114_2894
Entry
ECNA114_2894      CDS       T01998                                 

Definition
(GenBank) putative oxidoreductase
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Aldo_ket_red YdiH
Other DBs
NCBI-ProteinID: AEG37731
Structure
PDB: 
1LQA

Position
2968669..2969709
AA seq 346 aa
MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPE
TQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKR
LQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSN
ETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGT
LTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHSLDPAQMALAFVRRQP
FVASTLLGATTMEQLKTNVESLHLELSEDVLAEIEAVHQVYTYPAP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgcaatatcaccgtataccccacagttcgctggaagtcagcacgctggggcttggcacg
atgacgtttggtgaacagaacagcgaagccgacgcccacgcacaactcgactatgccgtc
gctcagggcattaaccttatcgacgttgccgaaatgtacccagtacctccgcgccccgaa
actcaagggctaaccgaaacctacgtcggcaactggctggcgaaacatggcagccgcgaa
aagttaattatcgcctccaaagtgagcggaccgtcgcgcaataatgacaaaggcatccgc
ccggatcaggcgctggatcggaagaatatccgtgaagcgctgcatgacagcctcaagcgt
ctgcagactgattacctcgatctctatcaggtgcactggccgcagcgcccaaccaactgc
ttcggcaaactcggttatagctggacagattctgcgcctgcggtttcgctgctggatacg
ctggacgcactggcagagtaccaacgcgcgggaaaaattcgttatataggcgtgtcgaac
gaaactgcatttggcgtaatgcgctacctgcatctggcggacaaacacgatctgccgcgt
attgtcaccattcagaacccctacagcctgttaaaccgcagttttgaagtaggtctggca
gaagtcagccagtatgaaggggtcgaactgctggcctattcgtgcctgggtttcggcacg
ctgaccgggaaatatctcaatggtgcaaaacccgctggcgcacgtaatacgctctttagt
cgcttcacccgctatagcggtgagcaaacgcaaaaagccgtcgcggcgtatgttgatatc
gccagacgtcatagcctggaccctgctcagatggcgctcgcatttgtacgccgtcaaccg
tttgttgccagcactctgctgggcgcaaccacgatggagcagctgaaaactaacgtcgaa
agtttgcatctggagttgagcgaagacgtattagctgaaattgaagcggtgcatcaggtt
tatacgtatcctgcaccataa

DBGET integrated database retrieval system