KEGG   Escherichia coli NA114 (UPEC): ECNA114_2895
Entry
ECNA114_2895      CDS       T01998                                 

Definition
(GenBank) Lysophospholipid transporter protein
  KO
K08227  MFS transporter, LPLT family, lysophospholipid transporter
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2895
Transporters [BR:ena02000]
 Major facilitator superfamily (MFS)
  Lipid transporters
   Lysophospholipid transporter (LplT) family [TC:2.A.1.42]
    ECNA114_2895
SSDB
Motif
Pfam: MFS_1 DUF1427
Other DBs
NCBI-ProteinID: AEG37732
Position
complement(2969741..2970889)
AA seq 382 aa
MKAVIVAQFLSAFGDNALLFATLALLKAQFYPEWSQPILQMVFVGAYILFAPFVGQVADS
FAKGRVMMFANGLKLLGAASICFGINPFLGYTLVGVGAAAYSPAKYGILGELTTGSKLVK
ANGLMEASTIAAILLGSVAGGVLADWHVLIALAACALAYGGAVIANIYIPKLAAARPGQS
WNLISMTRSFLNACTSLWRNGETRFSLVGTSLFWGAGVTLRFLLVLWVPVALGITDNATP
TYLNAMVAIGIVVGAGAAAKLVTLETVSRCMPAGILIGVVVLIFSLQHELLPAYALLMLI
GVLGGFFVVPLNALLQERGKKSVGAGNAIAVQNLGENSAMLLMLGIYSLAVMVGIPVVPI
GIGFGALFALAITALWIWQRRH
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaagcggttatcgtggcgcagtttctctctgcgtttggcgataatgcgctactgttt
gctactctggcgttactgaaagcgcagttctatccggagtggagccagcccatcctgcaa
atggtgtttgtaggtgcttacattctttttgcgccgtttgtcgggcaggtggcggatagc
ttcgccaaaggccgggtgatgatgtttgccaacggcctgaagctactgggcgcagccagt
atctgctttggtatcaatccgtttctcggctatacgttggtgggtgttggtgctgcagcc
tattcaccggcgaaatacggtattctcggcgaattaaccacgggtagtaagttagtaaaa
gctaacggtttaatggaggcgtctaccatagcggcgattttgctcggttccgtagctggt
ggtgttctggctgactggcatgtcctgatcgccctggccgcatgcgcactggcctacggt
ggcgcggtcattgccaatatctacattcccaaactggcggcggcgcgtccggggcagtcc
tggaatctcatcagcatgacccgcagtttcctgaatgcctgcacctcgctatggcgcaat
ggtgaaacgcgtttttcgctggtgggcaccagtttattctggggagcgggtgtcacgctg
cgtttcctgttggtgctgtgggtaccggtggcgctgggtattaccgataacgctacgccg
acctatctcaacgcgatggtagcgattggtatcgtggttggtgcaggtgcggcagcgaag
ttagttacgctggaaaccgtgtcacgctgtatgccagccgggattttgattggcgtggtg
gtactgattttctccctgcaacacgagctgctgccagcctatgctttgttgatgctgatt
ggcgtgctggggggtttttttgtcgttccgctcaatgcgttgctacaggagcggggtaaa
aaaagcgtcggggcggggaatgcgattgcagtacaaaaccttggcgaaaacagcgccatg
ttgttgatgctgggcatttactcgctggcggtaatggtaggcatcccggtcgtgcccatt
ggcattggcttcggtgcgctgtttgcgctggcaataacggcgctgtggatctggcagcgc
cgtcattaa

DBGET integrated database retrieval system