KEGG   Escherichia coli NA114 (UPEC): ECNA114_2896
Entry
ECNA114_2896      CDS       T01998                                 

Gene name
aas
Definition
(GenBank) 2-acylglycerophosphoethanolamine acyltransferase / Acyl-acyl-carrier-protein synthetase
  KO
K05939  acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase / long-chain-fatty-acid--[acyl-carrier-protein] ligase [EC:2.3.1.40 6.2.1.20]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00071  Fatty acid degradation
ena00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECNA114_2896 (aas)
   00564 Glycerophospholipid metabolism
    ECNA114_2896 (aas)
Enzymes [BR:ena01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.40  acyl-[acyl-carrier-protein]---phospholipid O-acyltransferase
     ECNA114_2896 (aas)
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.20  long-chain-fatty-acid---[acyl-carrier-protein] ligase
     ECNA114_2896 (aas)
SSDB
Motif
Pfam: AMP-binding Acyltransferase AMP-binding_C
Other DBs
NCBI-ProteinID: AEG37733
Position
complement(2970927..2973086)
AA seq 719 aa
MLFSFFRNLCRVLYRVRVTGDTKALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS
ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG
AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD
RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK
TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA
AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQL
KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG
LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR
LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM
DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENIRGEMERGWYDTGDIVR
FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT
TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgctttttagcttttttcgaaatttgtgccgtgttttgtatcgcgttcgcgttacgggt
gacaccaaggcactgaagggcgagcgcgttctaatcacgcctaatcacgtctcttttatt
gatggcatactgctggcattgtttttacccgtacgtccggtatttgccgtttacacctca
ataagccaacagtggtatatgcgttggctgaaatcatttatcgactttgttcctctcgac
ccgacgcaacctatggcgattaaacatctggtacgtctggtggaacagggccgaccagtg
gtgattttccctgaaggacgcatcaccaccactggctcgctgatgaaaatctacgatggc
gcgggatttgtcgcggcgaagtctggtgcaacggttattcctgtgcgtattgaaggggcg
gaacttacgcacttcagccgcctgaaaggtctggttaaacgtcgcttgttcccgcaaatt
actctgcatattttgccaccaacgcaggtggagatgccggatgcgccgcgtgcccgtgac
cgtcgcaaaatcgctggcgaaatgctgcatcaaataatgatggaggcgcgtatggcggtg
cgcccgcgtgaaacgctgtacgaatctttactgagcgcaatgtaccgcttcggagccggg
aagaaatgtgtcgaagacgtcaactttaccccagactcctatcgcaaattgcttacgaaa
acgctgtttgttggacgcatccttgaaaaatacagtgttgaaggcgaacgcatcggctta
atgctgcccaatgcaggcatcagtgcggcagtgatttttggggccatcgcccgtcgccgc
attcccgcaatgatgaactacaccgccggggtaaaagggctgaccagtgctattacggcg
gctgaaatcaaaaccatcttcacttcccgtcagtttctcgataaaggcaaactctggcat
ctgccggagcaacttactcaggtgcgctgggtctatctggaagatttaaaagcagatgtc
accactgccgacaaagtgtggattttcgctcatttgctgatgccgcgtctggcacagtta
aaacagcagccggaagaagaagcgctgatcctctttacctccggttctgaaggccatccg
aaaggcgtcgtccatagccataaaagcattctggcgaacgttgagcagattaaaacgatt
gccgacttcaccaccaacgatcgctttatgtcggcgttaccgctgtttcactcctttggg
ctgacggtaggcctgtttacgccactgctcacaggtgcagaagtgttcctttatccaagc
ccgctgcattaccgcattgtgccggagttggtgtatgaccgcagttgcaccgtgttgttc
ggtacctcgactttcctcggtcactacgcgcgctttgccaacccgtatgacttctatcgt
ctacgctatgtggtggcaggcgcagaaaaactacaagaaagtaccaaacagctttggcag
gataaatttggcctgcgcatccttgaaggctacggtgtgaccgaatgcgcgcctgtcgtt
tctatcaacgtaccgatggcggcgaaacccggtacggtagggcgtattctaccaggaatg
gatgcgcgcctgttgtcggttcctggtatcgaagagggcggacgcctgcaactgaaaggg
ccgaacataatgaacggctatctgcgggtggagaagcctggtgtactggaagtgcccacc
gccgagaatattcgcggcgaaatggagcgcggctggtatgacactggcgatatcgtgcgt
tttgatgagcagggctttgtgcagattcagggccgcgcaaaacgctttgccaaaattgca
ggcgaaatggtgtcgctggaaatggtggaacaactggcacttggtgtttcgccagataaa
gtccatgccactgcgattaagagcgatgccagcaaaggcgaggcactggtgcttttcacc
acagataacgaactgacgcgcgataagttacaacagtatgcccgcgagcacggcgtgccg
gagcttgctgtaccgcgcgatattcgctatctgaaacagatgccattacttggcagcggc
aaacctgactttgtcacgttgaaaagctgggtagacgaagcggaacaacacgatgagtga

DBGET integrated database retrieval system