KEGG   Escherichia coli NA114 (UPEC): ECNA114_2897
Entry
ECNA114_2897      CDS       T01998                                 

Gene name
galR
Definition
(GenBank) Galactose operon repressor
  KO
K02529  LacI family transcriptional regulator
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ena03000]
    ECNA114_2897 (galR)
Transcription factors [BR:ena03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    ECNA114_2897 (galR)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_Tnp_ISL3 HTH_3 PucR HTH_23 HTH_26 MerR HTH_31 HTH_17 DUF3853 HTH_38
Other DBs
NCBI-ProteinID: AEG37734
Position
2973672..2974703
AA seq 343 aa
MATIKDVARLAGVSVATVSRVINNSPKASEASRLAVHSAMESLSYHPNANARALAQQTTE
TIGLVVGDVSDPFFGAMVKAVEQVAYHTGNFLLIGNGYHNEQKERQAIEQLIRHRCAALV
VHAKMIPDADLASLMKQMPGMVLINRILPGFENRCIALDDRYGAWLATRHLIQQGHTRIG
YLCSNHSISDAEDRLQGYYDALAESGIPANDRLVTFGEPDESGGEQAMTELLGRGRNFTA
VACYNDSMAAGAMGVLNDNGIDVPGEISLIGFDDVLVSRYVRPRLTTVRYPIVTMATQAA
ELALALADNRPLPEITNVFSPTLVRRHSVSTPSLEASHHATSD
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcgaccataaaggatgtagcccgactggcaggcgtttcagtcgccaccgtttcccgc
gtcattaataattcacccaaagccagcgaagcttcccgactggctgtgcatagtgcaatg
gagtctcttagctatcacccgaacgccaacgcccgtgcgctggcgcagcagaccactgaa
acgatcggtctggtcgttggtgatgtttccgatccgtttttcggtgcaatggtgaaagcg
gtcgaacaggtggcttatcacactggtaattttttattgattggcaacggttaccacaac
gaacaaaaagagcgtcaggccattgagcaactgatccgccatcgctgtgctgcgctggtt
gtccatgccaaaatgatcccggatgccgatttagcctcattaatgaaacaaatgcccggt
atggtgctgatcaaccgtatcctgcctggctttgaaaaccgttgtattgctctggacgat
cgttacggtgcctggctggcaacgcgtcatttaattcagcaaggtcatacccgcattggt
tatctgtgctctaaccactctatttctgacgccgaagatcgtctgcaagggtattacgat
gcccttgctgaaagtggtattccggccaatgaccggctggtgacatttggcgaaccagac
gaaagcggcggcgaacaggcaatgaccgagcttttgggacgaggcagaaatttcactgcg
gtagcctgttataacgattcaatggcggcgggcgcgatgggcgtgctcaatgataatggt
attgatgtaccgggtgagatttcgttaattggctttgatgatgtgctggtgtcacgctat
gtgcgtccgcgcctgaccaccgtgcgttacccaatcgtgacgatggcgacgcaggctgcc
gaactggctttggcgctggcggataatcgccctctcccggaaatcactaatgtctttagt
ccgacgctggtacgtcgccattcagtgtcaactccgtcgctggaggcaagtcatcatgca
accagcgactaa

DBGET integrated database retrieval system