KEGG   Escherichia coli NA114 (UPEC): ECNA114_2898
Entry
ECNA114_2898      CDS       T01998                                 

Gene name
lysA
Definition
(GenBank) Diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00300  Lysine biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01230  Biosynthesis of amino acids
Module
ena_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ECNA114_2898 (lysA)
Enzymes [BR:ena01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     ECNA114_2898 (lysA)
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Other DBs
NCBI-ProteinID: AEG37735
Structure
PDB: 
1KNW 1KO0

Position
complement(2974710..2975972)
AA seq 420 aa
MPHSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDVVRFAQKACSNIH
ILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVN
AGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQR
HHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVLEFGQDLQAISAGGGLSIPYQQGEEAVD
TEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQAGVLITQVRSVKQMGSRHFVLVDA
GFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRA
LPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALELL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgccacattcactgttcagcactgataccgatctcaccgccgaaaatctgctgcgtttg
cccgcagaatttggctgcccggtgtgggtctacgatgcgcaaattattcgtcggcagatt
gcggcgctgaaacagtttgatgtggtgcgctttgcacagaaagcctgttccaatattcat
attttgcgcttaatgcgtgagcagggcgtaaaagtggattccgtctcgttaggtgaaata
gagcgtgcactggcggcgggttacaatccgcaaacgcaccctgatgatattgtttttacg
gcagatgttatcgatcaggcgacgcttgaacgcgtcagtgaattgcaaattccggtgaat
gcgggttctgttgatatgctcgaccaactggggcaggtttcgccagggcatcgggtatgg
ctgcgtgttaatccggggtttggtcacgggcatagccaaaaaaccaataccggtggcgaa
aacagcaagcacggtatctggtacaccgatctgcccgccgcactggacgtgatacaacgt
catcatctacagctggtcggcattcacatgcacattggttctggcgtcgattatgcccat
ctggaacaggtatgtggtgctatggtgcgtcaagtcctcgaattcggtcaggatttacag
gctatttctgcgggcggtgggctttctattccttatcaacagggtgaagaggcggttgat
accgaacattattatggtctgtggaatgccgcgcgtgagcaaatcgcccgccatttgggc
catcctgtgaaactggaaattgaaccgggtcgctttctggtagcgcaggctggcgtatta
attactcaagtgcggagcgtcaaacaaatgggtagccgccactttgttctggttgatgcc
gggttcaacgatctgatgcgcccggcaatgtacggtagttaccaccatatcagtgccctg
gcagctgatggtcgttctctggaacacgcgccaacggtggaaaccgtcgtcgccgggccg
ttatgtgaatcgggcgatgtctttacccagcaggaagggggaaatgtcgaaacccgcgcc
ttgccggaagtgaaggcgggtgattatctggtactgcatgatacaggggcatatggcgcg
tcaatgtcatccaactacaacagccgtccgctgttaccagaagttctgtttgataatggt
caggcgcggttgattcgccgtcgccagaccattgaagaattactggcgctggaattgctt
taa

DBGET integrated database retrieval system