KEGG   Escherichia coli NA114 (UPEC): ECNA114_2899
Entry
ECNA114_2899      CDS       T01998                                 

Gene name
lysR
Definition
(GenBank) Transcriptional activator protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: LysR_substrate HTH_1 HTH_23 HTH_30 HTH_28
Other DBs
NCBI-ProteinID: AEG37736
Position
2976094..2977029
AA seq 311 aa
MAAVNLRHIEIFHAVMTAGSLTEAAHLLHTSQPTVSRELARFEKVIGLKLFERIRGRLHP
TVQGLRLFEEVQRSWYGLDRIVSAAESLREFRQGELSIACLPVFSQSFLPQLLQPFLARY
PDVSLNIVPQESPLLEEWLSAQRHDLGLTETLHTPAGTERTELLSLDEVCVLPPGHPLAV
KKVLTPDDFHGENYISLSRTDSYRQLLDQLFTENQVKRRMIVETHSAASVCAMVRAGVGV
SVVNPLTALDYAASGLVVRRFSIAVPFTVSLIRPLHRPSSALVQAFSEHLQAGLPKLVTS
LDAILSSATTA
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccgccgttaacttacgtcatattgaaatttttcatgcggtaatgaccgccggaagc
ctgactgaggcggcacacctgctacacacctcacagccaaccgtcagccgcgaactggcg
cgctttgagaaggtgatcgggctgaaattgtttgagcgcatacgtggacgattacatcct
accgtgcaaggactgcgtctgtttgaagaagtgcaacgatcctggtacggactggatcgc
attgtcagtgccgcagaaagtctgcgcgagtttcgccagggagaactgtctattgcctgc
ctgccggtcttttcgcaatcttttttaccgcagctcctgcaaccctttctggcacgttat
cccgatgtcagcttaaatatcgtgccccaggaatcaccgctacttgaagagtggctctcg
gcccagcgtcatgatttaggactcactgaaacgctccatacgcctgcgggaacagaacgt
accgaattactctctttagatgaagtgtgtgtgttacctccgggccatccgctggcggta
aaaaaggtattaacgccggatgattttcacggtgagaactacatcagcctttcccgtact
gacagctatcgccagttgctggatcaattgtttactgagaatcaggttaaacgacgcatg
atcgtagaaacccacagcgccgcgtcagtctgcgcaatggtacgggcgggggtaggcgtt
tcagtggttaacccgctcaccgcactggattatgcggcaagcggtttagtggtgcggcgg
ttcagcattgcggttccattcaccgtcagcctgatccgccccctgcaccgcccgtcatca
gcgctggtgcaggcgtttagtgagcatttacaagcgggattaccgaaactggtcacttct
cttgacgctattttgtcgtcagctacgacagcataa

DBGET integrated database retrieval system