KEGG   Escherichia coli NA114 (UPEC): ECNA114_2900
Entry
ECNA114_2900      CDS       T01998                                 

Gene name
ygeA
Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Asp_Glu_race Pantoate_transf CHASE2
Other DBs
NCBI-ProteinID: AEG37737
Structure
PDB: 
5HRA 5HQT 5HRC 5ELL 5ELM

Position
complement(2977016..2977708)
AA seq 230 aa
MKTIGLLGGMSWESTIPYYRLINEGIKQRLGGLHSAQVLLHSVDFHEIEECQRRGEWDKT
GDILAEAALGLQRAGAEGIVLCTNTMHKVADAIESRCSLPFLHIADATGRAITGAGMTRV
ALLGTRYTMEQDFYRGRLTEQFSINCLIPEADDRAKINQIIFEELCLGQFTEASRAYYAQ
VIARLAEQGAQGVIFGCTEIGLLVPEERSVLPVFDTAAIHAEDAVAFMLS
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaaaacaattggtttgctgggaggaatgagctgggaatccactattccttactatcgt
ctgataaatgaaggcattaaacagcggcttggtgggcttcactctgcgcaagtgctgcta
catagcgtcgattttcatgaaatagaagagtgccagcgtcgcggtgagtgggacaaaacc
ggggatattctggctgaggcggcgcttggcttacagcgggcgggcgcagaaggtattgtg
ttatgcaccaatacgatgcacaaagtggcggatgccattgagtctcgttgctctctgcct
ttcttacacatagcggatgccactggacgtgcaattaccggggcaggaatgactcgtgtg
gcgctgctgggtacacgttacaccatggaacaggatttttatcgcgggcggctgacggaa
caattttccatcaactgtcttattcctgaagcggatgaccgggcgaaaattaatcagatt
atttttgaagaactgtgtctggggcaatttaccgaagcgtcacgcgcttattatgcgcaa
gtgattgctcgccttgcagaacagggcgcacagggcgtcatttttggctgcacagaaatt
ggtttactggtgccagaagagcgcagtgttctgcctgtgtttgataccgcggcgatccat
gccgaggatgctgtcgcttttatgctgtcgtag

DBGET integrated database retrieval system