KEGG   Escherichia coli NA114 (UPEC): ECNA114_2901
Entry
ECNA114_2901      CDS       T01998                                 

Gene name
araE
Definition
(GenBank) Arabinose-proton symporter protein
  KO
K02100  MFS transporter, SP family, arabinose:H+ symporter
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2901 (araE)
Transporters [BR:ena02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    ECNA114_2901 (araE)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_2
Other DBs
NCBI-ProteinID: AEG37738
Position
complement(2977837..2979255)
AA seq 472 aa
MVTINTESALTPRPLRDTRRMNMFVSVAAAVAGLLFGLDIGVIAGALPFITDHFVLTSRL
QEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARV
VLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWRAM
LGVLALPAVLLIILVVFLPNSPRWLAEKGRHIEAEEVLRMLRDTSEKAREELNEIRESLK
LKQGGWALFKINRNVRRAVFLGMLLQAMQQFTGMNIIMYYAPRIFKMAGFTTTEQQMIAT
LVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVMALGTLVLGYCLMQFDNGTASSGLSWL
SVGMTMMCIAGYAMSAAPVVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLTLLD
SIGAAGTFWLYTALNIAFVGITFWLIPETKNVTLEHIERKLMAGEKLRNIGV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggttactatcaatacggaatctgctttaacgccacgtcctctgcgggatacgcggcgt
atgaatatgtttgtttcggtagctgctgcggtcgcaggattgttatttggtcttgatatc
ggcgtaatcgccggagcgttgccgttcattaccgatcactttgtgctgaccagtcgtttg
caggaatgggtggtcagtagcatgatgctcggtgcagcaattggtgcgctgtttaatggt
tggctgtcgttccgcctggggcgtaaatacagcctgatggcgggggccatcctgtttgta
ctcggttcgatagggtccgcttttgcgaccagcgtagagatgttaatcgccgctcgtgtg
gtgttgggcattgctgtcgggatcgcgtcttacaccgctcctctatatctttctgaaatg
gcaagtgaaaacgttcgcggtaagatgatcagcatgtaccagttgatggtcactctcggc
atcgtgctggcgtttttatccgatacagcgttcagttatagcggtaactggcgcgcaatg
ttgggggttcttgctttaccagcagttctgctgattattctggtggtcttcctgccaaat
agcccgcgctggctggcggaaaaggggcgtcatattgaggcggaagaagtattgcgtatg
ctgcgcgatacgtcggaaaaagcgcgagaagaactcaacgaaattcgcgaaagcctgaag
ttaaaacagggcggttgggcactgtttaagatcaaccgtaacgtccgtcgtgctgtattt
ctcggtatgttgttgcaggcgatgcagcagtttaccggtatgaacatcatcatgtactac
gcgccacgtatcttcaaaatggcgggctttacgaccacagaacaacagatgattgcgact
ctggtcgtggggctgacctttatgttcgctaccttcattgcggtctttacggtagataaa
gcagggcgtaagccggcgctgaaaattggtttcagcgtgatggcgttaggcactctggtg
ctgggttactgcctgatgcagtttgataacggtacggcttccagtggcttgtcctggctc
tctgttggcatgacgatgatgtgtattgccggttatgcgatgagcgccgcgccagtggtg
tggatcttgtgctctgaaattcagccgctgaaatgccgcgattttggcatcacctgctca
acgacgacaaactgggtgtcgaatatgattatcggcgcgaccttcctgacactgcttgat
agcattggcgctgccggtacgttctggctctacactgcgctgaacattgcgtttgtgggc
atcactttctggctcattccggaaaccaaaaatgtcacgctggaacatatcgagcgcaaa
ctgatggcaggcgaaaagttgagaaatatcggcgtctga

DBGET integrated database retrieval system