KEGG   Escherichia coli NA114 (UPEC): ECNA114_2902
Entry
ECNA114_2902      CDS       T01998                                 

Gene name
kduD
Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
  KO
K00065  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase [EC:1.1.1.127]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00040  Pentose and glucuronate interconversions
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECNA114_2902 (kduD)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.127  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
     ECNA114_2902 (kduD)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: AEG37739
Position
complement(2979570..2980331)
AA seq 253 aa
MILSAFSLEGKVAVVTGCDTGLGQGMALGLAQAGCDIVGINIVEPTETIKQVTALGRRFL
SLTADLRKIDGIPALLDRAVAEFGHIDILVNNAGLIRREDALEFSEKDWDDVMNLNIKSV
FFMSQAAAKHFIAQGNGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWAKHN
INVNAIAPGYMATNNTQQLRADEQRSAEILDRIPAGRWGLPSDLMGPVVFLASSASDYVN
GYTIAVDGGWLAR
NT seq 762 nt   +upstreamnt  +downstreamnt
atgattttaagtgcattttctctcgaaggtaaagttgcggtcgtcactggttgtgatact
gggctgggccaggggatggcgttggggctggcgcaagcgggctgtgacattgttggcatt
aacatcgttgaaccgactgaaaccatcaagcaggtcacggcgctggggcgtcgtttttta
agcctgaccgccgatctgcgaaagattgatggcattccagcactgctggatcgcgcggta
gcggagtttggtcatattgatatcctggtgaataacgccggattgattcgccgcgaagac
gctctcgaattcagcgaaaaagactgggacgatgtcatgaacctgaatatcaagagcgta
ttcttcatgtctcaggcagcggcgaaacactttatcgcgcaaggcaatggcggcaagatt
atcaatatcgcgtcaatgctctccttccagggcgggatccgtgtgccttcttataccgca
tcaaaaagcggtgtgatgggcgtgacgcgattgatggcgaacgaatgggctaaacacaac
attaatgttaatgcgatagctccgggttacatggcgaccaacaatactcaacaactgcgg
gcagatgaacaacgtagcgcggaaattctcgaccgcattccagctggccgttggggactg
ccgagtgacctgatggggccggtggtgttccttgcctccagcgcttcagattatgtgaat
ggttataccattgccgtggatggcggttggctggcgcgttaa

DBGET integrated database retrieval system