KEGG   Escherichia coli NA114 (UPEC): ECNA114_2903
Entry
ECNA114_2903      CDS       T01998                                 

Gene name
kduI
Definition
(GenBank) 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase
  KO
K01815  4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC:5.3.1.17]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00040  Pentose and glucuronate interconversions
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECNA114_2903 (kduI)
Enzymes [BR:ena01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.17  5-dehydro-4-deoxy-D-glucuronate isomerase
     ECNA114_2903 (kduI)
SSDB
Motif
Pfam: KduI
Other DBs
NCBI-ProteinID: AEG37740
Structure
PDB: 
1XRU 1X8M

Position
complement(2980361..2981197)
AA seq 278 aa
MDVRQSIHSAHAKTLDTQGLRNEFLVEKVFVADEYTMVYSHIDRIIVGGIMPVTKTVSVG
GEVGKQLGVSYFLERRELGVINIGGAGTITVDGQCYEIGHRDALYVGKGAKEVVFASIDT
ATPAKFYYNCAPAHTTYPTKKVTPDEVSPVTLGDNLTSNRRTINKYFVPDVLETCQLSMG
LTELAPGNLWNTMPCHTHERRMEVYFYFNMDDDACVFHMMGQPQETRHIVMHNEQAVISP
SWSIHSGVGTKAYTFIWGMVGENQVFDDMDHVAVKDLR
NT seq 837 nt   +upstreamnt  +downstreamnt
gtggacgtaagacagagcatccacagcgcgcacgcaaaaacgctggatacccaggggctg
cgcaatgaatttttggttgaaaaggtatttgtcgccgatgagtacaccatggtttacagc
cacattgaccgtattattgttggcggcattatgccggtaactaaaacggtttccgttggc
ggggaagttggtaaacaactcggcgtaagctatttccttgaacgtcgcgagttaggtgtt
atcaatattggcggtgccggtacgattactgtcgatggtcaatgctatgaaatcggtcac
cgcgacgccctgtatgttggtaaaggtgcaaaagaagttgtctttgccagtattgatacc
gccactccggcgaagttttattacaattgcgcacccgcgcatacgacgtatcccaccaaa
aaagtcacaccggacgaagtatctccagtcacgttaggcgataacctcaccagtaaccgt
cgcacgattaacaaatattttgtcccggatgtgctggaaacctgccaattgagtatgggg
ctgacggagctggctccaggtaacttgtggaacaccatgccgtgtcacacccacgagcgc
cggatggaagtttatttctatttcaatatggatgatgacgcctgcgttttccacatgatg
gggcaaccgcaagaaacgcgtcacattgtgatgcataacgagcaggcggtgatctccccg
agctggtcgatccattccggcgtcggaaccaaagcttatacctttatctggggcatggtc
ggtgaaaaccaggtttttgatgatatggaccatgtggccgttaaagatttgcgctag

DBGET integrated database retrieval system