KEGG   Escherichia coli NA114 (UPEC): ECNA114_2904
Entry
ECNA114_2904      CDS       T01998                                 

Gene name
yqeF
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00071  Fatty acid degradation
ena00280  Valine, leucine and isoleucine degradation
ena00310  Lysine degradation
ena00362  Benzoate degradation
ena00380  Tryptophan metabolism
ena00620  Pyruvate metabolism
ena00630  Glyoxylate and dicarboxylate metabolism
ena00640  Propanoate metabolism
ena00650  Butanoate metabolism
ena00900  Terpenoid backbone biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
ena01212  Fatty acid metabolism
ena02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNA114_2904 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    ECNA114_2904 (yqeF)
   00640 Propanoate metabolism
    ECNA114_2904 (yqeF)
   00650 Butanoate metabolism
    ECNA114_2904 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECNA114_2904 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    ECNA114_2904 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNA114_2904 (yqeF)
   00310 Lysine degradation
    ECNA114_2904 (yqeF)
   00380 Tryptophan metabolism
    ECNA114_2904 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECNA114_2904 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNA114_2904 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECNA114_2904 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ena04147]
    ECNA114_2904 (yqeF)
Enzymes [BR:ena01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECNA114_2904 (yqeF)
Exosome [BR:ena04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNA114_2904 (yqeF)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Other DBs
NCBI-ProteinID: AEG37741
Position
complement(2981484..2982665)
AA seq 393 aa
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVITQSNGQTLVVDTDEQPRTDTSAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggcagcctggtcgtcaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtgattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaagacaatcggctattaaaggtggtcttcctaatagcgtttct
gcaatcactattaatgacgtttgtggttccgggcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggcgcacagcttggcaatagccagttggtt
gatagtcttgtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaataacccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacaccagcgcagaaggcttagcccgtttaaatccttcatttgatagtctcggttct
gtgacagcgggtaatgcatcatccataaacgatggggcagctgcagtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtggatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgttggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgaatgggatgagcgtcgggtcaatgttaat
ggtggtgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
cttgttcatgaaatggtgaaacgtaatgcccgcaaaggactggcaacgctttgtatcggc
ggaggccagggtgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system