KEGG   Escherichia coli NA114 (UPEC): ECNA114_2905
Entry
ECNA114_2905      CDS       T01998                                 

Gene name
yqeG
Definition
(GenBank) putative transport protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Trp_Tyr_perm Aa_trans Saf_2TM AA_permease_2
Other DBs
NCBI-ProteinID: AEG37742
Position
2982920..2984149
AA seq 409 aa
MSNIWSKEETLWSFALYGTAVGAGTLFLPIQLGSAGAVVLFITALVAWPLTYWPHKALCQ
FILSSKTSAGEGITGAVTHYYGKKIGNLITTLYFIAFFVVVLIYAVAITNSLTEQLAKHM
VIDLRIRMLVSLGVVLILNLIFLMGRHATIRVMGFLVFPLIAYFLFLSIYLVGSWQPDLL
TTQVEFNQNTLHQIWISIPVMVFAFSHTPIISTFAIDRREKYGEHAMDKCKKIMKVAYLI
ICISVLFFVFSCLLSIPPSYIEAAKEEGVTILSALSMLPNAPAWLSISGIIVAVVAMSKS
FLGTYFGVIEGATEVVKTTLQQVGVKKSRAFNRALSIMLVSLITFIVCCINPNAISMIYA
ISGPLIAMILFIMPTLSTYLIPALKPWRSIGNLITLIVGILCVSVMFFS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtctaatatttggtcaaaagaagaaactctgtggagtttcgcactctacggcacagcc
gttggtgcaggcacgctcttccttcctattcagttaggttcggcgggggctgtggtcctg
tttattactgctctggtcgcctggcctttaacatattggccacataaagccttatgccag
ttcatcctctcatcgaaaacatcagcaggtgaagggataacgggcgcggtaacacactac
tatggcaagaagattggtaatctgattaccacgctgtacttcatcgccttttttgtcgtc
gtgttgatatatgcagtggcaattaccaactcacttacggaacagctggcaaagcatatg
gttattgatcttcgcatccgtatgctagtgagtctgggggttgtattaatcctgaatctc
atttttctgatgggacgccatgccactattcgggtaatgggatttttggtattcccattg
attgcctatttcttatttctttctatttacctggtcggtagttggcaacctgatctatta
acaacccaggtagagttcaatcagaatacccttcaccagatatggatatcgattcccgtg
atggttttcgcttttagccatacgcccattatttctacgtttgccatagacagacgtgaa
aaatatggcgaacatgctatggataaatgcaaaaaaattatgaaagtcgcttatctcatc
atctgcataagtgtattgttctttgtctttagctgcctgctttctattccaccttcgtat
attgaagcggctaaagaagaaggggttaccattttatcggcgctttctatgctgccgaac
gccccagcatggttgtcaatttccgggattattgtcgcagtagttgcgatgtcgaaatca
ttcctgggtacgtactttggcgttattgaaggtgccacagaggtcgtcaaaacaacatta
cagcaggttggtgtaaagaaaagtcgtgcatttaaccgcgcactatcaattatgttggta
tcgctgattaccttcattgtttgttgcattaacccgaacgcgatttcgatgatttacgcg
atcagcggcccgctcattgccatgatacttttcatcatgcctacgctgtcaacgtatctc
atcccggcgcttaaaccctggcgttccatcggaaatctgattaccctgatcgtgggtatc
ctgtgcgtatcggtaatgttctttagctaa

DBGET integrated database retrieval system