KEGG   Escherichia coli NA114 (UPEC): ECNA114_2908
Entry
ECNA114_2908      CDS       T01998                                 

Gene name
ygeT
Definition
(GenBank) Xanthine dehydrogenase, FAD binding subunit
  KO
K13479  xanthine dehydrogenase FAD-binding subunit [EC:1.17.1.4]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00230  Purine metabolism
ena01100  Metabolic pathways
ena01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNA114_2908 (ygeT)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECNA114_2908 (ygeT)
SSDB
Motif
Pfam: FAD_binding_5 CO_deh_flav_C
Other DBs
NCBI-ProteinID: AEG37745
Position
2988095..2988973
AA seq 292 aa
MFDFASYHRAATLADAINLLTDNPQAKLLAGGTDVLIQLHHHNDRYRHIVDIHNLAELRG
ITLAEDGALRIGSATTFTQLIEDPVTQRHLPALCAAAASIAGPQIRNVATYGGNICNGAT
SADSATPTLIYDAKLEIHSPRGVRFVPINGFHTGPGKVSLEHDEILVAFHFPPQPKEHAG
SAHFKYAMRDAMDISTIGCAAHCRLDNGNFSELRLAFGVAAPTPIRCQHAEQTAQNAPLN
LQTLEAISESVLQDVAPRSSWRASKEFRLHLIQTMTKKVISEAVAAAGGKLQ
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtttgattttgcttcttaccatcgcgcagcaacccttgccgatgccatcaacctgctg
actgacaacccgcaggccaaactgctcgccggtggcactgacgtactgatacagcttcac
catcacaatgaccgttatcgccatattgttgatattcataatctggcggagctgcgggga
attacgctggcggaagatggcgcgctacgtatcggctctgcaacgacatttacccagctc
attgaagatcctgtaactcaacgtcatctcccggcgttatgtgctgcggctgcatcaatc
gccgggccgcagatccgtaatgtcgccacctacggcggaaatatttgcaacggtgccacc
agcgcagattctgccacgccaacgctaatttatgacgcgaaactggagatccactccccg
cgcggtgttcgtttcgtcccgattaatggctttcacaccgggccgggcaaagtgtctctt
gagcatgacgaaatccttgtcgcctttcattttccgccacagccgaaagaacacgcgggc
agcgcgcattttaaatatgccatgcgcgacgcaatggatatttcaacaattggctgcgcc
gcacattgccgactggataacggcaatttcagcgaattacgcctggcatttggtgttgcc
gcgccaacgccgattcgctgccaacatgccgaacagactgcacaaaatgcgccattaaac
ctgcaaacgctggaagccatcagcgaatcagtcctgcaagatgtcgccccgcgttcgtca
tggcgggccagtaaagagtttcgtctgcatctcatccagacgatgaccaaaaaagtgatt
agcgaagccgtcgccgcggcgggggggaaattgcaatga

DBGET integrated database retrieval system