KEGG   Escherichia coli NA114 (UPEC): ECNA114_2910
Entry
ECNA114_2910      CDS       T01998                                 

Gene name
ygeV
Definition
(GenBank) putative sigma-54-dependent transcriptional regulator protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 HTH_50 PAS_8 AAA_5 PAS AAA_16 PAS_7 AAA Mg_chelatase PAS_4 PAS_9 HTH_28 HTH_Tnp_1 HTH_23 AAA_2 AAA_7 HATPase_c_5 HTH_17 MCM GAF HTH_Tnp_ISL3 HTH_7
Other DBs
NCBI-ProteinID: AEG37747
Position
complement(2989488..2991266)
AA seq 592 aa
MELATTQSVLMQIQPTIQRFARMLASVLQLEVEIVDENLCRVAGTGAYGKFLGRQLSGNS
RLLRHVLETKTEKVVTQSRFDPLCEGCDSKENCREKAFLGTPVILQDRCVGVISLIAVTH
EQQEHISDNLREFSDYVRHISTIFVSKLLEDQGPGDNISKIFATMIDNMDQGVLVVDADN
RVQFVNQTALKTLGVVQNNIIGKPVRFRPLTFESNFTHGHMQHIVSWDDKSELIIGQLHN
IQGRQLFLMAFHQSHTSFSVANAPDEPHIEQLVGECRVMRQLKRLISRIAPSPSSVMVVG
ESGTGKEVVARAIHKLSGRRNKPFIAINCAAIPEQLLESELFGYVKGAFTGASANGKTGL
IQAANTGTLFLDEIGDMPLMLQAKLLRAIEAREILPIGASSPIQVDIRIISATNQNLAQF
IAEGKFREDLFYRLNVIPITLPPLRERQEDIELLVHYFLHLHTRRLGSVYPGIAPDVVEI
LRKHRWPGNLRELSNLMEYLVNVVPSGEVIDSTLLPPNLLNNGTTEQSDVTEASEAHLSL
DDAGGTALEEMEKQMIREALSRHNSKKEVADELGIGIATLYRKIKKYELLNT
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggagcttgcgactacgcagtcagtattgatgcaaattcaaccaacaattcagcgtttt
gccagaatgcttgccagcgttttgcagcttgaggttgagatcgttgatgaaaacttgtgt
cgcgtcgccggaacgggcgcgtatgggaagtttcttggccgccagttgagcggcaactca
cgtctgctccgccacgtcctggaaacgaaaactgaaaaagttgtgacacagtctcgcttc
gatcccctttgtgaaggttgcgatagtaaagaaaattgccgcgaaaaagcatttctgggt
acgccagtcattttacaggatcgttgtgttggggtgataagtttgattgccgttacccac
gagcaacaagaacatatcagtgataatttacgcgaattttccgattacgttcgccatata
tccaccatttttgtttctaaacttctggaggatcagggaccaggagataacatcagtaaa
atattcgcgaccatgatcgataatatggatcagggcgtgttagtggttgatgctgataat
cgggttcagtttgttaatcagacagctttaaaaacactcggtgttgtacaaaataatatt
attggaaaacctgttcgtttcagaccattaacatttgagagtaattttacccatggtcat
atgcaacatattgtttcgtgggatgataaaagtgaattaatcattggtcagttgcataac
atccagggccgacaactatttttaatggcgtttcaccaatcgcataccagtttttctgta
gcaaatgcacctgatgaaccgcatattgaacaattggttggcgagtgccgtgttatgcgg
caattaaaacgactcattagccgtattgcacccagcccatccagcgttatggtggttggt
gaaagcggcacgggtaaagaagtcgtcgcccgtgcaatccataagttgagcggaagacgg
aataaaccctttattgctatcaactgtgccgcgattccggaacagcttctggagagcgaa
ctgttcggttatgttaaaggcgcatttactggcgcttctgccaacggtaaaacagggttg
attcaggcggcgaatacgggcacgctgtttctcgatgaaattggtgatatgccattaatg
ttgcaggctaaattactgcgcgctattgaggcgcgtgaaattctgccgattggtgccagt
agcccaatacaagtcgacatccgcatcatttctgcaactaatcagaatttggcccagttc
attgccgaaggtaaattccgcgaagatctcttctaccgacttaatgttatcccgataact
cttccaccgctgcgtgaacgtcaggaagatattgaattactagtgcattactttttacat
ctgcatacccgtcgtctgggatcggtttatcctggcattgctcctgatgtcgtcgaaata
ttgcgtaagcatcgttggcccggaaacctgcgcgagttaagcaatttgatggaatatctg
gttaacgttgttccttcaggtgaagttatcgacagcacgctattgccgccaaatctgctg
aataatggcacaacggagcaaagtgatgtaacagaggccagtgaggcgcacctgtcactc
gatgatgcgggcggcacggcgctggaagagatggaaaagcaaatgatccgcgaggcgctt
tcacgtcataacagcaagaaggaagttgctgatgaactgggcatcggcattgctacgctc
tatcgcaagattaagaaatatgagttgttaaacacataa

DBGET integrated database retrieval system