KEGG   Escherichia coli NA114 (UPEC): ECNA114_2911
Entry
ECNA114_2911      CDS       T01998                                 

Gene name
ygeW
Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: OTCace OTCace_N
Other DBs
NCBI-ProteinID: AEG37748
Structure
PDB: 
3Q98

Position
2991742..2992932
AA seq 396 aa
MMKTVNELIKDINSLTSHLHEKDFLLTWEQTPDELKQVLDVAAALKALRAENISTKVFNS
GLGISVFRDNSTRTRFSYASALNLLGLAQQDLDEGKSQIAHGETVRETANMISFCADAIG
IRDDMYLGAGNAYMREVGAALDDGYKQGVLPQRPALVNLQCDIDHPTQSMADLAWLREHF
GSLENLKGKKIAMTWAYSPSYGKPLSVPQGIIGLMTRFGMDVTLAHPEGYDLIPDVVEVA
KNNAKASGGSFRQVTSMEEAFKDADIVYPKSWAPYKVMEERTELLRANDHEGLKALEKQC
LAQNAQHKDWHCTEEMMELTRDGEALYMHCLPADISGVSCKEGEVTEGVFEKYRIATYKE
ASWKPYIIAAMILSRKYAKPGALLEQLLKEAQERVK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgatgaaaactgttaatgagctgattaaggatatcaattcgctgacctctcacctgcat
gaaaaagattttttgttaacgtgggaacagacgccagacgaactgaaacaagtactggac
gttgccgccgcgttaaaagcactgcgtgctgaaaacatctcaaccaaagtctttaatagt
ggattaggtatttccgtattccgcgacaattccacccgtacccgcttctcttatgcttcc
gcgcttaacctgctcggccttgcacaacaagatcttgacgaaggtaaatcacaaatcgct
cacggcgaaaccgtgcgtgaaaccgccaatatgatctccttctgcgctgacgctatcggt
attcgcgacgatatgtatctgggcgcaggcaacgcctatatgcgtgaagttggcgctgca
cttgatgacggttacaagcagggtgtgctgccgcagcgtccggctttagtgaacctgcaa
tgcgatattgaccacccgactcaatcaatggctgatctggcatggttacgtgaacacttt
ggttcactggaaaacctgaaaggtaaaaaaatcgccatgacctgggcctactccccaagc
tatggcaaaccgctctctgtaccacaaggcatcatcggtctgatgacccgcttcggtatg
gatgtcaccctggcccatccggaaggctacgacctgatcccggatgtcgttgaagttgct
aaaaacaatgctaaagcctccggtggtagcttccgtcaggtcaccagcatggaagaagcc
ttcaaagacgcagacatcgtttatccgaagtcctgggcaccttacaaagtgatggaagag
cgtactgaactgctgcgtgcgaacgatcacgaaggactgaaagcgctggaaaaacagtgt
ctggcacagaacgcacagcacaaagactggcattgtaccgaagagatgatggagctgacc
cgtgatggcgaagccctgtacatgcactgcctgccagctgatatcagcggcgtatcctgc
aaagaaggtgaagtgactgaaggcgtattcgaaaaataccgtatcgctacctacaaagaa
gccagctggaagccttatatcatcgccgcgatgatcctgtcccgtaaatacgccaaacca
ggtgcactgctcgagcaactgctgaaagaagcgcaagaacgcgtgaaataa

DBGET integrated database retrieval system