KEGG   Escherichia coli NA114 (UPEC): ECNA114_2912
Entry
ECNA114_2912      CDS       T01998                                 

Gene name
ygeX
Definition
(GenBank) Putative diaminopropionate ammonia-lyase
  KO
K01751  diaminopropionate ammonia-lyase [EC:4.3.1.15]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECNA114_2912 (ygeX)
Enzymes [BR:ena01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.15  diaminopropionate ammonia-lyase
     ECNA114_2912 (ygeX)
SSDB
Motif
Pfam: PALP Polysacc_deac_2
Other DBs
NCBI-ProteinID: AEG37749
Structure
PDB: 
4D9I 4D9K 4D9G 4D9M 4D9N

Position
2992990..2994186
AA seq 398 aa
MSVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVK
KILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTD
GNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQ
QHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGV
LGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVNVGGDMATIMAGLACGEPNPLGWE
ILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLM
EKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVAP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtccgttttctcattaaagattgatatcgccgataacaaatttttcaacggcgaaaca
tcaccgcttttttcgcaaagccaggcaaaactggcacgccagttccaccagaaaattgct
ggttatcgcccaacaccgctttgtgcgctggacgatctcgcaaacctgtttggtgtaaag
aaaattctcgttaaggacgaatcaaaacgcttcggtctgaacgccttcaaaatgctcggc
ggcgcatacgccatcgctcaattattgtgtgaaaaatatcatcttgatatcgaaacgcta
tcatttgagcacctgaaaaatgccattggcgaaaaaatgactttcgcgaccaccaccgac
ggcaaccacgggcgcggtgtggcatgggccgctcagcaactcggacagaatgcggtgatt
tacatgccgaaaggttctgctcaggaacgcgttgacgccattctaaacctcggtgccgag
tgcatcgtcacggatatgaactatgacgataccgttcgcctgaccatgcaacacgcgcag
cagcacggctgggaagtggtacaggacacggcatgggaaggttacaccaaaatcccaacc
tggatcatgcaaggctacgcaacactggcggatgaagccgtcgagcaaatgcgtgaaatg
ggcgtaaccccgacacacgttctgctgcaagcaggtgtcggtgcaatggccggtggtgtg
ctgggttatctggtcgacgtctatagcccgcaaaatctgcacagcattattgttgaacct
gacaaagctgactgtatttatcgctccggcgtcaaaggcgacatcgtcaacgttggcggt
gatatggccaccatcatggcgggcctggcctgcggcgaacctaacccgctgggctgggaa
atcctacgtaactgcgccacccaattcatctcctgccaggacagcgttgccgcattaggt
atgcgcgtgctgggtaatccgtacggcaacgacccgcgcatcatctccggtgaatccggc
gctgtcggtttgggcgttctcgcagcggttcattatcacccgcaacgtcaaagcctgatg
gaaaaactggcgctgaacaaagatgccgtggtgctggttatcagcactgaaggcgacacc
gacgtgaagcactaccgcgaagttgtctgggaaggcaaacacgctgtagcaccttaa

DBGET integrated database retrieval system