KEGG   Escherichia coli NA114 (UPEC): ECNA114_2913
Entry
ECNA114_2913      CDS       T01998                                 

Gene name
ygeY
Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer
Other DBs
NCBI-ProteinID: AEG37750
Position
2994244..2995455
AA seq 403 aa
MAKNIPFKLILEKAKDYQADMTRFLRDMVAIPSESCDEKRVVHRIKEEMEKVGFDKVEID
PMGNVLGYIGHGPRLVAMDAHIDTVGIGNIKNWDFDPYEGMETDELIGGRGTSDQEGGMA
SMVYAGKIIKDLGLEDEYTLLVTGTVQEEDCDGLCWQYIIEQSGIRPEFVVSTEPTDCQV
YRGQRGRMEIRIDVQGVSCHGSAPERGDNAIFKMGPILGELQELSQRLGYDEFLGKGTLT
VSEIFFTSPSRCAVADSCAVSIDRRLTWGETWEGALDEIRALPAVQKANAVVSMYNYDRP
SWTGLVYPTECYFPTWKVEEDHFTVKALVNAYEGLFGKAPVVDKWTFSTNGVSIMGRHGI
PVIGFGPGKEPEAHAPNEKTWKSHLVTCAAMYAAIPLSWLATE
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctaagaatattccattcaaactgattcttgaaaaagcaaaagattaccaggcagac
atgactcgcttcctgcgcgatatggttgctattcccagtgaaagctgcgacgagaaacgc
gtagtacatcgtattaaagaagagatggaaaaagtcggcttcgataaagttgaaatcgac
ccaatgggcaacgttctcggttatatcggccacggcccgcgtctggtggcaatggacgct
catatcgatacagtcggcattggcaacatcaaaaactgggacttcgatccgtatgaaggc
atggaaaccgacgagctgatcggtggtcgtggtacttccgaccaggaaggcggcatggcg
tctatggtatatgccggtaaaatcattaaagatctcggtctggaagatgaatataccctg
ctggttaccggtactgtgcaggaagaagactgcgacggcctgtgctggcagtacattatt
gaacaatccggcattcgcccggaatttgtggtcagtaccgaaccaaccgactgccaggta
taccgtggtcaacgcggtcgtatggaaattcgtattgatgttcagggtgttagctgccac
ggttcggcaccagaacgcggtgataacgccattttcaaaatgggtccgattcttggcgaa
ttacaagaactctcccaacgtctgggttatgacgaattcctcggcaaaggcaccctcacc
gtttctgaaattttcttcacctccccaagccgttgcgctgtcgcagacagctgcgcagtt
tcaatcgaccgtcgtctgacctggggcgaaacctgggaaggcgcgctggacgagatccgt
gccctgcctgcagtacaaaaagcgaatgctgtcgtttctatgtacaactacgaccgcccg
tcctggactggcctggtttacccaaccgaatgctacttcccgacctggaaagtggaagaa
gatcacttcaccgttaaagcactggtgaatgcttatgaagggctgtttggtaaagcgcct
gtcgttgataagtggaccttctcgactaatggcgtatccatcatgggtcgccacggcatt
ccggtcatcggttttggccccggtaaagaaccggaagcgcacgcgccaaacgaaaaaacc
tggaaatctcacctggtaacctgtgccgctatgtacgctgcaatcccattaagctggctg
gcaaccgaataa

DBGET integrated database retrieval system