KEGG   Escherichia coli NA114 (UPEC): ECNA114_2914
Entry
ECNA114_2914      CDS       T01998                                 

Gene name
ygeZ
Definition
(GenBank) hypothetical protein
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00240  Pyrimidine metabolism
ena00410  beta-Alanine metabolism
ena00770  Pantothenate and CoA biosynthesis
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECNA114_2914 (ygeZ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECNA114_2914 (ygeZ)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECNA114_2914 (ygeZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ena04147]
    ECNA114_2914 (ygeZ)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     ECNA114_2914 (ygeZ)
Exosome [BR:ena04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNA114_2914 (ygeZ)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-ProteinID: AEG37751
Position
2995496..2996893
AA seq 465 aa
MEFAMRVLIKNGIVVNADGQAKQDLLIESGIVRQLGTDISPQLPCEEIDASGCYVFPGGV
DVHTHFNIDVGIARSCDDFFTGTRAAACGGTTTIIDHMGFGPNGCRLRHQLEVYRGYAAH
KAVIDYSFHGVIQHINHAILDEIPMMVEEGLSSFKLYLTYQYKLNDDEVLQALRRLHESG
ALTTVHPENDAAIASKRAEFIAAGLTAPRYHALSRPLECEAEAIARMINLAQIAGNAPLY
IVHLSNGLGLDYLRLARANHQPVWVETCPQYLLLDERSYDTEDGMKFILSPPLRNVREQD
KLWCGISDGAIDVVATDHCTFSMAQRLQISKGDFSRCPNGLPGVENRMQLLFSSGVMTGR
ISPERFVELTSAMPARLFGLWPQKGLLAPGSDGDVVIIDPRQSQQIQHRHLHDNADYSPW
EGFTCQGAIVRTLSRGETIFCDGTFTGKAGRGRFLRRKPFVPPVL
NT seq 1398 nt   +upstreamnt  +downstreamnt
ttggagtttgctatgcgcgtattgataaaaaacggcattgttgttaatgcagatggacag
gcgaagcaggatttgctgattgaaagcgggattgttcgccagttgggtaccgatatttcg
ccgcaactcccttgcgaagaaattgatgcctctggctgttacgttttccctggcggcgtg
gatgtccatacgcatttcaatattgatgtcggcatcgcgcgcagttgtgatgattttttt
accggtacccgcgcagctgcgtgtggcggtacaacaaccattattgaccatatgggattt
ggcccaaatggctgccggttacgccatcaactggaagtttatcgcggttatgccgcccac
aaagcagtcatcgactacagctttcacggtgtcattcaacatattaatcacgctatcctc
gacgaaattccgatgatggttgaggaaggactgagcagttttaaactctatttaacctat
caatataaactcaacgatgatgaagtgttgcaggcattacgccgcttgcatgagtccggc
gcgctgaccaccgtgcacccggaaaatgacgcagctatcgccagcaagcgggcggagttt
atcgccgcagggttaaccgcgccgcgttatcatgccttgagtcgacctctggaatgcgaa
gcggaagccatcgcccgcatgattaacctggcacaaattgccggtaacgccccgctctat
atcgtgcacctgtctaacggcttaggtctggattatctgcgtcttgcccgtgcgaatcac
cagccagtctgggttgaaacctgcccacaatatctcctgttggacgaacgcagttacgat
acagaagatggcatgaagttcattcttagcccaccgctgcgtaacgtacgcgagcaggac
aaactgtggtgtggcatcagcgatggtgcgattgacgtggtggcaaccgatcactgcacc
ttctcgatggctcaacgcctgcaaatttctaaaggcgatttcagccgctgcccaaatggc
ttacccggtgtggagaaccgcatgcaactgctgttctccagtggcgtgatgacggggcgt
atctcaccggagcgttttgttgagttaaccagtgcaatgcccgccaggctgtttggcctg
tggccacaaaaaggattattagcgcccggttccgatggcgacgtggtgattatagaccca
cgtcagagccaacaaattcagcatcgccatctccacgacaacgctgactactcgccatgg
gagggttttacctgtcagggcgcgattgtcagaaccttatcccgtggtgaaacgattttc
tgcgacggcacctttacaggcaaagccgggcgaggtcgtttcctgcgacgcaaaccgttt
gtccctcccgtgctctaa

DBGET integrated database retrieval system