KEGG   Escherichia coli NA114 (UPEC): ECNA114_2915
Entry
ECNA114_2915      CDS       T01998                                 

Gene name
yqeA
Definition
(GenBank) Carbamate kinase-like protein
  KO
K00926  carbamate kinase [EC:2.7.2.2]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00220  Arginine biosynthesis
ena00230  Purine metabolism
ena00910  Nitrogen metabolism
ena01100  Metabolic pathways
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ECNA114_2915 (yqeA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNA114_2915 (yqeA)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ECNA114_2915 (yqeA)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.2  carbamate kinase
     ECNA114_2915 (yqeA)
SSDB
Motif
Pfam: AA_kinase AlaDh_PNT_N
Other DBs
NCBI-ProteinID: AEG37752
Position
2996941..2997873
AA seq 310 aa
MSKKIVLALGGNALGDDLAGQMKAVKITSQAIVDLIAQGHEVIVTHGNGPQVGMINQAFE
AAAKTEAHSPMLPMSVCVALSQGYIGYDLQNALREELLSRGINKPVATLVTQVEVDANDP
AFLNPTKPIGSFFTEQEAELLTKQGYTLKEDAGRGYRRVVASPKPVDIIEKETVKALVDA
GQVVITVGGGGIPVIREGNHLRGASAVIDKDWASARLAEMIDADMLIILTAVEKVAINFG
KENEQWLDRLSLSDAERFIEEGHFAKGSMLPKVEAAASFARSRAGREALITVLSKAKEGI
EGKTGTVICQ
NT seq 933 nt   +upstreamnt  +downstreamnt
atgagtaagaaaattgttctcgccctgggcgggaatgcgctgggcgatgacctggccgga
caaatgaaagcggtaaaaattacttctcaggcaattgttgatttaattgcccagggacat
gaggtcatcgtcactcatggcaacgggccacaggtgggcatgattaaccaggcctttgaa
gctgccgcaaaaactgaagcgcactcgccaatgctgccgatgtctgtctgtgttgcctta
agccagggttatattggttacgatctacaaaacgccttaagagaagaactgctttctcgt
ggcattaataaacctgtagcaacgctggttacccaggtcgaagtcgatgctaacgatccg
gcattcctcaacccgaccaagccgattggttcgttctttaccgagcaagaagcagagcta
ctgacaaaacagggttacactctgaaagaagatgcgggtcgcggctatcgtcgtgtcgtt
gcttcgccaaaaccggttgatatcattgaaaaagaaacggttaaagctctggtagatgcc
ggacaggtggtgatcaccgttggcggtggtggtatccctgttattcgtgaaggtaaccat
ctgcgtggtgccagcgcggttatcgataaagactgggccagtgcccgtttagcagaaatg
atcgatgccgatatgctgatcattctgactgcggtagaaaaagtggccattaacttcgga
aaagagaatgaacagtggctcgatcgcctgtcattaagtgatgctgaacgctttatcgaa
gaaggtcattttgcgaaaggttctatgctgcctaaagtggaagctgccgcctcgtttgct
cgctctcgcgcaggtcgtgaagcactgattaccgtattgagcaaagcgaaagaagggatt
gaaggcaaaaccggaacggtgatttgtcagtaa

DBGET integrated database retrieval system