KEGG   Escherichia coli NA114 (UPEC): ECNA114_2916
Entry
ECNA114_2916      CDS       T01998                                 

Gene name
yqeB
Definition
(GenBank) hypothetical protein
  KO
K07402  xanthine dehydrogenase accessory factor
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ECNA114_2916 (yqeB)
SSDB
Motif
Pfam: XdhC_C XdhC_CoxI 3HCDH_N 2-Hacid_dh_C F420_oxidored Biotin_lipoyl Biotin_lipoyl_2 Peptidase_M23
Other DBs
NCBI-ProteinID: AEG37753
Position
complement(2997914..2999539)
AA seq 541 aa
MNIFTEAAKLEEQNCPFAMAQIVDSRGSTPRHSAQMLVRADGSIVGTIGGGMVERKVIEE
SLQALQERKPRLFHGRMARNGADAVGSDCGGAMSVFISVHGMRPRLVLIGAGHVNRAIAQ
SAALLGFDIAVADIYRESLNPELFPPSTTLLHAESFGAAVEALDIRPDNFVLIATNNQDR
EALDKLIEQPIAWLGLLASRRKVQLFLHQLREKGVAEEHIARLHAPVGYNIGAETPQEIA
ISVLAEILQVKNNAPGGLMMKPSHPSGHQLVVIRGAGDIASGVALRLYHAGFKVIMLEVE
KPTVIRCTVAFAQAVFDGEMTVEGVTARLATSSAEAMKLTERGFIPVMVDPTCSLLDELK
PLCVVDAILAKQNLGTRADMAPVTIALGPGFTAGKDCHAVIETNRGHWLGQVIYSGCAQE
NTGVPGNIMGHTTRRVIRAPAAGIMRSNVKLGDLVKEGDVIAWIGEHEIKAPLTGMVRGL
LNDGLAVVGGFKIGDIDPRGETADFTSVSDKARAIGGGVLEALMMLMHQGVKATKEVLEV
A
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgaatattttcacagaggctgcaaaactcgaagagcaaaattgtccgtttgcgatggcg
caaattgttgatagccgaggctcaaccccccgccattctgcacaaatgttagtgcgcgcc
gatggttctatcgtcggtacaattggtggcggaatggttgagcggaaggtgattgaagag
tcgcttcaggcattgcaggaacgtaagccgcgattattccatggacgtatggctcgtaac
ggtgcggatgctgtcgggtcagattgtggaggtgcaatgtcagtatttatcagcgtccat
ggtatgcgtccacgtctggtgttgattggtgcggggcatgtcaaccgggcgatagcccag
agtgcggcgctattaggatttgatatcgccgttgccgatatttatcgcgaaagcctcaat
cctgaactattcccaccatcaaccacgcttctccatgctgagtcgtttggtgcggcagtg
gaagcactggatattcgccctgataattttgtcctgattgccacgaataatcaggatcgt
gaagccctcgacaaactcattgaacaacccattgcatggctggggttgctggcaagtcgc
cgcaaggttcagcttttcctacaccaattgcgtgagaaaggcgtggctgaagaacatatt
gcccgtttacatgcgcccgttggttacaacataggtgcggaaacgccgcaggagatcgcc
atcagcgtgctggcagaaatattacaggtgaaaaataacgcgccgggtgggctgatgatg
aagccttctcatccttccggacaccagctggtggtgattcgcggtgcgggggatatcgcc
agtggtgtagcgctacgtctgtatcatgcgggttttaaagtgatcatgttggaagtggaa
aaaccgacagtgattcgttgtaccgtggcgtttgcccaggccgtgttcgatggcgaaatg
acggtcgaaggcgtcaccgcccgcctggcaaccagctctgcggaagcgatgaaacttacc
gaacgcggatttatccctgtgatggtagatcccacctgttcattgcttgatgaactgaaa
ccgctttgcgtggtggacgctattctggcgaaacagaatttgggaacgcgggcagatatg
gcaccagtaacaatcgcgcttgggccgggctttactgcagggaaggattgtcatgcggta
attgaaacaaatcgcgggcactggctcggtcaggtgatttactcaggttgtgcgcaggag
aataccggtgttcccggcaatattatggggcataccacccgacgagtgatccgcgctcct
gctgcaggcattatgcgatccaacgtgaaattaggcgatctggtgaaagagggcgatgtc
attgcctggattggtgagcatgaaattaaagcaccgttgacggggatggtgcgtggcttg
ttgaacgacggactggccgtggtcggtggttttaaaattggtgatatcgatcctcgtggt
gaaacggctgatttcaccagcgtttctgataaagcccgggcgattggcggcggcgtactt
gaggcgttaatgatgttgatgcatcagggcgttaaagcgacaaaagaagtgctggaagtg
gcttaa

DBGET integrated database retrieval system