KEGG   Escherichia coli NA114 (UPEC): ECNA114_2917
Entry
ECNA114_2917      CDS       T01998                                 

Gene name
yqeC
Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: LpxK
Other DBs
NCBI-ProteinID: AEG37754
Position
complement(2999587..3000294)
AA seq 235 aa
MISIVGAGGKTSLLFWLAELFQASGRRVLITTTTHMFMPTSHWPVVFCRDPAMLPHASFI
SPISFCFHCWKANQGKVQGFTPEAIDALVQRPECDVILIEADGSRGMPLKAPDEHEPCIP
KSSCCVIAVMGGHILGAKVSTENVHRWSQFADITGLTPDAPLQLSDLVALVRHPQGAFKN
VPQGCRRVWFINRFSQCENAIAQSELLQPLQQHNVEAIWLGDIQEHPAIARRFVN
NT seq 708 nt   +upstreamnt  +downstreamnt
gtgatttctattgttggtgctggggggaaaaccagcttgcttttttggctggcagaactg
ttccaggcgagtggcaggcgtgtattaatcactacgacgacacatatgtttatgccaaca
tctcactggcccgtggttttctgtcgtgatcccgccatgcttcctcatgcgtcttttata
tcccccatttcattttgttttcactgctggaaagcgaaccagggaaaagtgcagggattt
acgccagaagcgattgatgcactggtacaacgaccagagtgtgacgtaattctcattgag
gcagatggctcgcgtggaatgccgttaaaagcgcctgatgagcacgaaccttgcatacct
aaaagcagttgctgcgtgattgctgtgatgggaggacatattttgggtgcgaaagtgagc
acagaaaatgtccatcgctggtcgcagtttgctgatattactgggttaacacctgatgca
cccttgcaactgagcgatctcgttgcgctggttcgccaccctcagggcgcgtttaaaaac
gtaccgcaaggttgtcggcgagtctggttcattaaccgtttttctcaatgtgagaatgcg
attgcgcaaagcgagctccttcaaccgctgcaacaacacaacgtagaggcaatctggctg
ggcgatatacaagaacatcctgcaatcgcgcgcagatttgtgaattag

DBGET integrated database retrieval system