KEGG   Escherichia coli NA114 (UPEC): ECNA114_2918
Entry
ECNA114_2918      CDS       T01998                                 

Gene name
ygfJ
Definition
(GenBank) hypothetical protein
  KO
K07141  molybdenum cofactor cytidylyltransferase [EC:2.7.7.76]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECNA114_2918 (ygfJ)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.76  molybdenum cofactor cytidylyltransferase
     ECNA114_2918 (ygfJ)
SSDB
Motif
Pfam: NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: AEG37755
Position
3000461..3001039
AA seq 192 aa
MSAIDCIITAAGLSSRMGQWKMMLPWQQGTILDTSIKNALQFCSRIILVTGYRGNELHER
YANQSNITIIHNPDYAQGLLTSVKAAVPAVQTEHCFLTHGDMPTLTIDIFRKIWSLRNDG
AILPLHNGIPGHPILVSKPCLMQAIQRPNVTNMRQALLMGEHYSVEIENAEIILDIDTPD
DFITAKKRYTEI
NT seq 579 nt   +upstreamnt  +downstreamnt
atgtcagccatcgactgtataattaccgccgcaggattatcatcaagaatggggcaatgg
aaaatgatgttaccctggcaacagggaacaattcttgatacaagtatcaaaaatgcgttg
cagttttgtagccgaattattttagtcaccggctatcgtggtaatgaactgcacgaacgt
tatgcgaaccagagcaatatcactattatccacaacccagattatgcgcagggtttactg
acatcagtaaaggccgcagtacccgcggtgcaaacagaacattgttttctcacccacgga
gatatgccaaccctcaccatcgatatttttagaaaaatctggtcgttacgaaatgatggc
gcaatactgccactccataatggcatccccggccatccgattttagtgtcaaaaccatgc
ctgatgcaggcaatccagcgccccaatgtcaccaatatgcgtcaggcactccttatggga
gaacattattccgtcgaaatagaaaatgcagaaataattttagatattgatactccggac
gactttattacagcgaagaaaaggtatactgaaatttag

DBGET integrated database retrieval system