KEGG   Escherichia coli NA114 (UPEC): ECNA114_2919
Entry
ECNA114_2919      CDS       T01998                                 

Gene name
ygfK
Definition
(GenBank) hypothetical protein
  KO
K12527  putative selenate reductase [EC:1.97.1.9]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_2919 (ygfK)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.9  selenate reductase
     ECNA114_2919 (ygfK)
SSDB
Motif
Pfam: Pyr_redox_2 Fer4_20 Pyr_redox_3 NAD_binding_8 Pyr_redox DAO Thi4 FAD_binding_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like Fer4_9 Fer4_7 ApbA Fer4_16 Fer4_10 PALP Amino_oxidase Rossmann-like 3HCDH_N K_oxygenase NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: AEG37756
Position
3001361..3004459
AA seq 1032 aa
MGDIMRPIPFEELLTRIFDEYQQQRSIFGIPEQQFYSPVKSKTVSVFGETCATPVGPAAG
PHTQLAQNIVTSWLTGGRFIELKTVQILDRLELEKPCIDAEDECFNTEWSTEFTLLKAWD
EYLKAWFALHLLEAMFQPSDSGKSFIFNMSVGYNLEGIKQPPMQQFIDNMMDASDHPKFA
QYRDALNKLLQDEAFLARHGLQEKRESLQALPARIPTSMVQGVTLSTMHGCPPHEIEAIC
RYMLEEKGLNTFVKLNPTLLGYARVREILDVCGFGYIGLKEESFDHDLKLTQALEMLERL
MALAKEKSLGFGVKLTNTLGTINNKGALPGEEMYMSGRALFPLSINVAAVLSRAFDGKLP
ISYSGGASQLTIRDIFDTGIRPITMATDLLKPGGYLRLSACMRELEGSDAWELNHVDVER
LNRLAADALTMEYTQKHWKPEERIEVAEDLPLTDCYVAPCVTACAIKQDIPEYIRLLGEH
RYADALELIYQRNALPAITGHICDHQCQYNCTRLDYDSALNIRELKKVALEKGWDEYKQR
WHKPAGSGSRHPVAVIGAGPAGLAAGYFLARAGHPVTLFEREANAGGVVKNIIPQFRIPA
ELIQHDIDFVAAHGVKFEYGCSPDLTVEQLKNQGFHYVLIATGTDKNSGVKLAGDNQNVW
KSLPFLREYNKGTALKLGKHVVVVGAGNTAMDCARAALRVPGVEKATVVYRRSLQEMPAW
REEYEEALHDGVEFRFLNNPERFDADGTLTLRVMSLGEPDEKGRRRPVETNETVTLHVDS
LITAIGEQQDTEALNAMGVPLDKNGWPDVDHNGETRLTDVFMIGDVQRGPSSIVAAVGTA
RRATDTILSRENIRSHQNDKYWNNVNPAEIYQRKGDISVTLVNSDDRDAFVAQEAARCLE
CNYVCSKCVDVCPNRANVSIAVPGFQNRFQTLHLDAYCNECGNCAQFCPWNGKPYKDKIT
VFSLSQDFDNSSNPGFLVEDCRVRVRLNNQSWVLNIDSEGQFNNVPPELNDMCRIISHVH
QHHHYLLGRVEV
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgggggatattatgcgtcccattccgtttgaggaacttttgacgcgcatatttgatgaa
taccaacaacaacgctcaatctttggtattcccgagcaacagttttactcacccgtaaaa
agtaaaactgttagcgtcttcggtgaaacctgtgccactcccgtcggccctgccgctggc
ccgcacacgcaactcgcgcaaaatattgtcacttcctggctgactggcggacgcttcatc
gaactaaaaaccgtccaaattcttgaccgtctggagctggaaaagccctgtatcgatgcc
gaagacgagtgctttaacaccgaatggtctaccgaatttaccctgcttaaagcctgggat
gaatacctcaaagcctggtttgccctgcaccttctcgaagcgatgttccagccttctgat
tccggtaaatcgttcatctttaatatgagcgtcggttacaacctcgaaggtattaagcaa
ccgccgatgcagcagttcatcgacaatatgatggacgcatctgaccatccgaaattcgct
caataccgcgatgcacttaataagctactccaggatgaggcatttttagcccgccacgga
ttgcaggaaaaacgcgaaagcttgcaagccttacccgctcgcatccccaccagcatggta
caaggtgttaccctctccaccatgcacggctgtcctccgcatgaaatcgaagccatttgc
cgctacatgctggaagaaaaaggactcaacacctttgtgaaactcaacccgaccttactg
gggtacgcgcgtgttcgtgagatcctcgatgtctgcggtttcggttacatcggcttaaaa
gaagagtcatttgatcacgacctcaagctgacgcaagcactggaaatgctggaacgcctg
atggcactggcaaaagaaaaatcactcggctttggcgtaaaactgactaacactctcggc
accatcaacaataaaggcgcactgcccggtgaagagatgtatatgtcaggccgtgcgctg
ttcccgctctccatcaacgttgcagcagttctctctcgcgcctttgacggcaaactgccc
atttcttattccggtggtgccagtcagctgactatccgcgatatttttgatactggtatt
cgccctattactatggcaaccgacctgctgaaacctggcggctatctgcgcttaagtgcc
tgcatgcgcgagctggaaggctccgacgcctgggagcttaaccacgttgacgtcgaacga
ctgaacagactggcagcagacgcgttaaccatggaatacacccagaaacactggaagcca
gaagagcgtattgaagtggctgaagacctgccgctgaccgattgctacgttgccccctgt
gttactgcctgcgctatcaagcaagatattccggaatacatccgtctgcttggcgaacac
cgctatgccgacgcgctggaactcatctatcaacgcaacgccctgcccgccattaccggt
catatttgcgatcaccagtgccaatacaactgtacccgcctggattacgacagtgcgctg
aatatccgcgaactgaaaaaagtcgccctggaaaaaggttgggatgaatataagcaacgc
tggcacaaaccagccggttccggttcacgccatccggtagccgtgattggtgcaggtccg
gcgggtctggccgcaggttacttccttgccagagcgggccatccggtcacgctgtttgaa
cgcgaagccaatgcgggcggcgtggtgaaaaatatcattcctcagttccgtattcctgca
gagttaattcagcacgatatcgattttgttgccgctcacggcgtgaaatttgagtacggt
tgctcacccgatttgaccgttgaacagttaaaaaatcagggcttccactatgttctgatt
gccaccggcactgataaaaatagcggtgtgaaactggcgggcgacaaccaaaatgtctgg
aaatcactccctttcctgcgtgaatacaacaagggcaccgcgctcaagctgggcaaacat
gtggtcgttgtcggggcgggtaacaccgcaatggactgcgctcgtgcggcgttacgcgtt
ccaggcgtagaaaaagcaacggtcgtttaccgtcgttcactgcaagaaatgcccgcatgg
cgcgaagagtatgaagaagcgttgcacgacggcgtggagttccgttttctgaataatccg
gaacgtttcgatgctgatggcaccttaaccttgcgcgttatgtcgcttggcgaacctgat
gagaaaggtcgtcgccgtccggttgaaaccaacgaaacagtaacactgcatgtggacagt
ctgatcaccgccattggtgaacagcaggatactgaagccctgaatgcgatgggcgtgccg
ctggacaaaaacggctggccagacgtcgaccataatggcgaaacgcgtctgactgacgtc
tttatgatcggcgacgtacagcgcggaccatcctccattgtcgctgctgtcggaaccgcg
cgtcgggcgaccgataccatccttagtcgggaaaatatccgttcccaccagaacgataaa
tactggaacaacgtaaatccggcggaaatctatcaacgtaaaggcgatatctctgtcact
ctggtgaacagtgacgatcgtgacgcgtttgtcgcacaggaagccgcacgctgccttgaa
tgtaactacgtttgcagcaagtgtgtggatgtctgcccgaaccgcgccaacgtatccatt
gcggttcctggcttccagaaccgtttccagacgctgcatctcgatgcctactgcaacgaa
tgcggcaactgcgcccaattctgcccgtggaacggtaaaccgtacaaagacaaaatcacc
gtcttcagcctgtcgcaagactttgataacagcagtaacccaggcttccttgtggaagat
tgccgggtacgcgtacgtctgaataaccaaagctgggtgttaaacatcgacagcgaaggt
cagttcaacaacgtaccaccggagctgaacgatatgtgccgcatcattagccatgtccac
cagcatcatcattatctgctgggccgcgtggaggtgtaa

DBGET integrated database retrieval system