KEGG   Escherichia coli NA114 (UPEC): ECNA114_2920
Entry
ECNA114_2920      CDS       T01998                                 

Definition
(GenBank) SsnA protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Amidohydro_1
Other DBs
NCBI-ProteinID: AEG37757
Position
3004462..3005790
AA seq 442 aa
MLILKNVTAVQLHPAKVQEGVDIAIENDVIVAIGDALTQRYPDASYKEMHGRIVMPGIVC
SHNHFYSGLSRGIMANIAPCPDFISTLKNLWWRLDRALDEESLYYSGLICSLEAIKSGCT
SVIDHHASPAYIDGSLSTLRNAFLKVGLRAMTCFETTDRNNGIKELQEGVEENIRFTRQI
DEAKKAATEPYLVEAHIGAHAPFTVPDAGLEMLREAVKSTGRGLHIHVAEDLYDVSYSHH
WYGKDLLARLAQFDLIDSKTLVAHGLYLSKDDIVLLNQRDAFLVHNARSNMNNHVGYNHH
LSDIRNLALGTDGIGSDMFEEMKFAFFKHRDAGGPLWPDSFAKALANGNELMSRNFGAKF
GLLEAGYKADLTICDYNSPTPLLADNIAGHIAFGMGSGSVHSVMVNGVMVYEDRQFNFDC
DSIYAQARKAAASMWRRMDALA
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgttgattctgaagaatgtcaccgcagtgcagttacacccggcgaaagtgcaggaaggc
gttgatatcgccatcgaaaatgatgtgattgtcgctatcggcgatgccctgacgcaacgc
taccccgatgccagctacaaagagatgcatggtcggattgtgatgccgggaattgtctgc
tcgcacaaccatttttactcggggctttcccgcggaattatggcaaacatcgccccctgc
ccggatttcatctcaacgctgaaaaatctctggtggcggctcgatcgcgctcttgatgaa
gagtcgctctattacagcggactgatttgttccctggaagcgattaagagcggatgtaca
tcggttatcgatcaccatgcctctccggcgtatatcgacgggtcgctctccacattgcgc
aacgcatttttaaaagttggcctgcgcgcgatgacctgttttgaaactactgaccgtaac
aacggcatcaaagagttgcaggaaggtgtagaagaaaacatccgcttcacccgtcagatt
gatgaggcgaagaaagcagcaaccgagccgtatctggtggaagcacatatcggcgctcac
gcgccgtttaccgtgccggatgccggtctggagatgctgcgtgaagccgtgaaaagcaca
ggtcgtggtttgcatattcacgttgcggaagacctttacgacgtttcctacagtcaccat
tggtacggcaaagacctgctggcacgacttgcgcaattcgatctcatcgacagcaaaacg
ctggtcgctcatgggctgtacctgtcgaaagatgacatcgtcctactcaatcagcgcgat
gcgttcctggtgcataacgcccgttcaaacatgaacaaccatgtcggctacaaccatcac
cttagcgacatccgcaatctggcgttgggaacggacggcattggttcggacatgtttgaa
gagatgaaatttgccttctttaaacatcgcgatgcgggtggcccgctgtggcctgacagt
tttgccaaagcactggctaacggcaacgaactgatgagccgcaactttggcgcgaaattt
gggcttctggaagccggttacaaagccgatttaaccatttgcgattacaactcgccgacg
ccgctgctggcagacaatatcgccgggcatatcgctttcggtatgggctcaggtagcgtt
cacagcgtgatggtcaatggtgtgatggtctatgaagaccgtcagtttaacttcgattgc
gattccatttatgcgcaagccagaaaagccgctgccagtatgtggcgtcggatggatgcg
ctggcataa

DBGET integrated database retrieval system