KEGG   Escherichia coli NA114 (UPEC): ECNA114_2921
Entry
ECNA114_2921      CDS       T01998                                 

Gene name
ygfM
Definition
(GenBank) hypothetical protein
  KO
K12529  putative selenate reductase FAD-binding subunit
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_2921 (ygfM)
SSDB
Motif
Pfam: FAD_binding_5 CO_deh_flav_C
Other DBs
NCBI-ProteinID: AEG37758
Position
3005841..3006620
AA seq 259 aa
MIEQFFRPDSVEQALELKRRYQDEAVWFAGGSKLNATPTRTDKKIAISLQDLELDWIDWD
NGALRIGAMSRLQPLRDARFIPAALREALGFVYSRHVRNQSTIGGEIAARQEESVLLPVL
LALDAELVFGNGETLSIEDYLACPCDRLLTEIIIKDPYRTCATRKISRSQAGLTVVTAAV
AITDHDGMRIALDGVASKALRLHDVETQNLEGNALEQAVANAIFPQEDLRGSVAYKRYIT
GVLVADLYADCQQAGEEAV
NT seq 780 nt   +upstreamnt  +downstreamnt
atgattgaacaatttttcagacccgactctgtcgaacaggcgctggaactgaagcgccgc
taccaggatgaagccgtctggttcgccgggggcagcaaactcaacgctacaccaacccgt
accgataaaaagattgccatttccttgcaggatctggagctggactggattgactgggat
aacggtgcactacgaattggcgcaatgtctcgcttgcagccactgcgtgatgcgcgattt
attcctgcagcactgcgggaagctctcggttttgtctactctcgccatgttcgtaatcag
tcgaccattggtggtgaaattgccgcccggcaagaagagtcagtgctgcttcccgtcctg
ctggcactggatgctgaactggtttttggcaacggcgaaacgctgtcaatcgaggactac
ctggcctgcccatgcgatcgcctgttaaccgaaattatcattaaagatccgtatcgcacc
tgtgcgactcgcaaaattagccgttctcaggcaggtttaaccgtcgtgacggcagccgtt
gcaataacagaccacgacggtatgcgaattgcgctggatggcgtcgccagtaaagcactg
cgtctgcatgatgttgaaactcaaaatctggaaggcaatgcactggaacaggctgtcgcc
aacgccattttcccgcaggaagatttgcggggcagcgtggcctataaacgctatatcacg
ggagttctggtagccgacctgtatgccgactgccaacaggctggggaggaagccgtatga

DBGET integrated database retrieval system