KEGG   Escherichia coli NA114 (UPEC): ECNA114_2922
Entry
ECNA114_2922      CDS       T01998                                 

Definition
(GenBank) putative hypoxanthine oxidase
  KO
K12528  putative selenate reductase molybdopterin-binding subunit
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_2922
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Fer2_2
Other DBs
NCBI-ProteinID: AEG37759
Position
3006617..3009487
AA seq 956 aa
MIIHFTLNGAPQELTVNPGENVQKLLFNMGMHSVRNSDDGFGFAGSDAIIFNGNIVNASL
LIAAQLEKADIRTAESLGKWNELSLVQQAMVDVGVVQSGYNDPAAALIITDLLDRIDAPT
REEIDDALSGLFSRDAGWQQYYQVIELAVARKNNPQATIDIAPTFRDDLEVIGKHYPKTD
AAKMVQAKPCYVEDRVTADACVIKMLRSPHAHALITHLDVSKAEALPGVVHVITHLNCPD
IYYTPGGQSAPEPSPLDRRMFGKKMRHVGDRVAAVVAESEDIALEALKLIDVEYEVLKPV
MSIDEAMAEDAPVVHDEPVVYVAGAPDTLEDDNSHAAQRGEHMIINFPIGSRPRKNIAAS
IHGHIGDMDKGFADADVIIERTYNSTQAQQCPTETHICFTRMDGDRLVIHASTQVPWHLR
RQVARLVGMKQHKVHVIKERVGGGFGSKQDILLEEVCAWATCVTGRPVLFRYTREEEFIA
NTSRHVAKVTVKLGAKKDGRLTAVKMDFRANTGPYGNHSLTVPCNGPALSLPLYPCDNVD
FQVTTYYSNICPNGAYQGYGAPKGNFAITMALAELAEQLQIDQLEIIERNRVHEGQELKI
LGAIGEGKAPTSVPSAASCALEEILRQGREMIQWSSPKPQNGDWHIGRGVAIIMQKSGIP
DIDQANCMIKLESDGTFIVHSGGADIGTGLDTVVTKLAAEVLHCPPQDVHVISGDTDHAL
FDKGAYASSGTCFSGNAARLAAENLREKILFHGAQILGEPVADVQLATPGVVRGKKGEVS
FGEIAHKGETGTGFGSLVGTGSYITPDFAFPYGANFAEVAVNTRTGEIRLDKFYALLDCG
TPVNPELALGQIYGATLRAIGHSMSEEIIYDAEGHPLTRDLRSYGAPKIGDIPRDFRAVL
VPSDDKVGPFGAKSISEIGVNGAAPAIATAIHDACGIWLREWHFTPEKILTALEKI
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgatcatccactttactttaaatggcgcgcctcaggagctaaccgttaatccaggcgaa
aacgtgcaaaagctgttgtttaacatgggaatgcactctgtacgcaacagtgatgatggc
tttgggtttgccggttctgacgcaattatctttaacggtaatatcgttaacgcgtccttg
cttatcgccgcacagttagagaaggcagatattcgtaccgcagaatctctgggcaaatgg
aatgagttaagtctggttcaacaggccatggttgatgttggcgtggtgcagtctggttat
aacgatccagctgcggctctgattatcaccgatcttctcgatcgcatcgacgcacctacc
cgcgaagagatcgacgacgcactctcaggtctgtttagccgcgatgctggctggcagcaa
tactatcaggtcattgaactggcggttgcacgtaaaaataatccgcaggccaccattgat
atcgctccgactttccgtgacgaccttgaagtcattggcaagcattatcctaaaactgat
gccgcgaaaatggtgcaggcgaaaccctgctatgttgaagatcgcgtaacggctgacgcc
tgcgtcattaaaatgttacgtagcccacacgctcacgcactgattactcatctggatgtc
agcaaagctgaagccttaccgggcgtcgttcacgttattactcacctgaattgcccggat
atttactataccccgggtggtcagagcgcaccggaaccgtcaccgcttgaccgccgaatg
ttcggcaagaaaatgcgtcacgtcggcgatcgcgttgctgcggtagtagccgaaagtgaa
gacattgcgctcgaagcactgaagctcatcgacgttgaatatgaagtgcttaagccggta
atgtcgattgacgaggcaatggcggaagatgcgcctgtcgtgcacgatgaaccggtggtg
tatgttgctggtgcgccagatactctggaagatgataacagccatgcagcccagcgcggc
gagcatatgatcatcaacttcccgatcggttctcgcccacgcaaaaatatcgccgccagt
attcatggtcatattggcgatatggacaaaggctttgccgatgccgatgtgatcattgag
cgaacctataattcaacgcaggcacagcagtgcccgactgaaacacatatctgctttacc
cgtatggacggcgatcgtctggtgatccacgcctccacccaggtaccatggcacttacgc
cgccaggtcgcgcgcctcgtgggcatgaaacagcataaagttcatgtcattaaagagcga
gttggcggcggttttggttccaaacaggacatcctgctggaagaagtgtgcgcctgggca
acctgcgtgaccgggcgtccggtacttttccgctacacccgtgaagaagagtttattgct
aacacctctcgtcacgtcgcgaaagtcaccgtcaaactgggcgcgaaaaaagatggtcgc
ctgacggcagtgaagatggatttccgcgccaacacgggtccttacggtaaccactcactc
accgtaccgtgtaacggaccggcgctgtcgctgccgttatatccatgcgataacgtcgat
tttcaggtcaccacctactacagcaacatttgcccaaatggtgcttatcagggttatggc
gcaccgaaaggtaacttcgctatcaccatggcattagcggaactggctgaacagttacag
atcgaccaactggaaattatcgaacgtaaccgggtacacgaagggcaagagctgaaaatt
ctcggtgcaatcggtgaaggtaaagcgccgacctccgttccttccgccgccagctgcgca
ctggaagagatcctgcgtcagggtcgcgagatgatccaatggtcttcaccaaaaccgcaa
aatggtgactggcacatcggtcgcggcgtcgccattatcatgcagaaatcgggtatcccg
gatatcgatcaggctaactgcatgatcaaactggaatcggatggcacctttatcgttcat
tccggtggtgcggatattggtactggtctggatactgtggtgaccaaactggcagcagaa
gtgctgcactgcccaccgcaggacgtgcatgttatctctggtgataccgatcatgcactg
tttgataaaggcgcatatgcctcgtccggtacttgcttctcgggtaacgctgcgcgtttg
gcagcggaaaatctgcgggagaaaatcctgttccacggcgcgcaaatattgggtgagcca
gtggcagatgttcaactagcaacgccgggcgtcgttcgcggcaagaaaggcgaagttagt
ttcggagagatagcccataaaggcgaaaccggcaccggctttggttcactggtgggaact
ggcagttatatcacacctgatttcgccttcccgtatggcgcaaacttcgctgaagttgcc
gtcaacacgcgtacgggtgaaatccgcctggataaattctacgccttgctggactgcggt
acaccggtcaatccagagttagcgttgggacaaatctacggtgccaccctgcgtgctatc
ggccacagtatgagcgaagagatcatttatgacgccgaaggtcacccgttaacgcgtgat
ttacgcagttacggcgcaccgaaaattggtgacattccgcgtgatttccgcgctgtgctg
gtgccgagcgacgataaagtcggcccattcggggcgaaatcgatctcggaaatcggtgta
aatggcgcagctccggcgattgctaccgcaattcacgatgcctgcggcatctggttacgc
gaatggcatttcacaccggagaaaatactcaccgcgctggaaaaaatataa

DBGET integrated database retrieval system