KEGG   Escherichia coli NA114 (UPEC): ECNA114_2923
Entry
ECNA114_2923      CDS       T01998                                 

Gene name
ygfO
Definition
(GenBank) Putative purine permease
  KO
K16346  xanthine permease XanQ
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2923 (ygfO)
Transporters [BR:ena02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ECNA114_2923 (ygfO)
SSDB
Motif
Pfam: Xan_ur_permease
Other DBs
NCBI-ProteinID: AEG37760
Position
3009595..3011052
AA seq 485 aa
MGIYFTNSDDQIYFKRSEGMSDINHAGSDLIFELEDRPPFHQALVGAITHLLAIFVPMVT
PALIVGAALQLSAETTAYLVSMAMIASGIGTWLQVNRYGIVGSGLLSIQSVNFSFVTVMI
ALGSSMKSDGFHEELIMSSLLGVSFVGAFLVVGSSFILPYLRRVITPTVSGIVVLMIGLS
LIKVGIIDFGGGFAAKSSGTFGNYEHLGVGLLVLIVVIGFNCCRSPLLRMGGIAIGLCVG
YIASLCLGMVDFSSMRNLPLITIPHPFKYGFSFSFHQFLVVGTIYLLSVLEAVGDITATA
MVSRRPIQGEEYQSRLKGGVLADGLVSVIASAVGSLPLTTFAQNNGVIQMTGVASRYVGR
TIAVMLVILGLFPMIGGFFTTIPSAVLGGAMTLMFSMIAIAGIRIIITNGLKRRETLIVA
TSLGLGLGISYDPEIFKILPASIYVLVENPICAGGLTAILLNIILPGGYRQENVLPGITS
AEEMD
NT seq 1458 nt   +upstreamnt  +downstreamnt
gtgggaatttattttactaattcagatgatcaaatttactttaaaaggagtgaagggatg
tctgatataaaccatgcaggttctgaccttatatttgaactggaggatcgccctcccttt
catcaggctctcgtaggtgccattacccatctgttggcaattttcgttccgatggtaacc
cccgcgttaatcgtgggtgcggccttacagctttccgctgaaacaactgcctatcttgtt
tctatggcgatgatcgcctctggtattggtacctggttacaagtaaaccgctacggcatc
gtcggttctggtttactttcaattcagtcagtcaatttttcatttgttacggtcatgatt
gcgctgggcagcagcatgaaaagcgacggttttcacgaagagttaatcatgtcgtcgctc
ctcggcgtctccttcgttggcgcatttctggttgtcggctcttcttttatcctgccctat
ttacgtcgggttattacgcctaccgtcagcggcattgtggtgctgatgatcggcttaagc
ctgattaaagtcggcattattgattttggtggaggatttgcagccaaaagcagcggtacg
ttcggcaattacgaacatctcggcgttggtttattggttttgattgtggtgatcggcttt
aactgctgtcgcagtccgttgctacgcatgggagggatcgccattgggctatgtgtcggc
tatatcgcatcgttatgcctgggcatggtggatttcagcagtatgcgcaatttgccgtta
atcaccatcccgcatccgttcaaatacggctttagttttagcttccatcagttcctggtg
gttggcacgatttatctgcttagcgtgctggaagctgtcggcgatatcaccgccacggca
atggtttcccgccgtcccattcagggggaagagtatcagtcccgactgaaaggcggcgtg
ctggcagatggtctggtttctgttatcgcctccgctgtcggttcattaccattaaccacg
tttgcgcaaaataatggggttattcagatgactggcgtcgcttcacgttatgtcgggcga
accatcgcggtaatgctggttatcctcggcttatttccgatgattggcggcttcttcacg
accattccctcagcagttctgggaggcgcaatgacgttgatgttttccatgattgccatc
gcagggattcgcatcatcatcaccaacggtttaaagcgccgtgaaacgcttattgttgcc
acttctttaggtttagggcttggtatctcctacgatcccgaaatttttaaaatattgcca
gcctctatttatgtattagttgaaaaccctatttgtgctggcgggttaactgcgatttta
ttaaatattatcctccctggtggctaccgacaggaaaacgttctgcctggtattacctca
gcggaagagatggattaa

DBGET integrated database retrieval system