KEGG   Escherichia coli NA114 (UPEC): ECNA114_2924
Entry
ECNA114_2924      CDS       T01998                                 

Gene name
ygfP
Definition
(GenBank) Guanine deaminase
  KO
K01487  guanine deaminase [EC:3.5.4.3]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00230  Purine metabolism
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNA114_2924 (ygfP)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.3  guanine deaminase
     ECNA114_2924 (ygfP)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 Peripla_BP_1
Other DBs
NCBI-ProteinID: AEG37761
Structure
PDB: 
6OHB 6OHC

Position
3011070..3012386
AA seq 438 aa
MSGEHTLKAVRGSFIDVTRTVDNPEEIASALRFIEDGLLLIKQGKVEWFGEWEDGKHQIP
DTIRVRDYRGKLIVPGFIDTHIHYPQSEMVGAYGEQLLEWLNKHTFPTERRYEDLEYARE
MSAFFIKQLLRNGTTTALVFGTVHPQSVDALFEAASHINMRMIAGKVMMDRNAPDYLLDT
AESSYHQSKELIERWHKNGRLLYAITPRFAPTSSPEQMAMAQRLKEEYPDTWVHTHLCEN
KDEIAWVKSLYPDHDGYLDVYHQYGLTGKNCVFAHCVHLEEKEWDRLSETKSSIAFCPTS
NLYLGSGLFNLKKAWQKKVKVGMGTDIGAGTTFNMLQTLNEAYKVLQLQGYRLSAYEAFY
LATLGGAKSLGLDDLIGNFLPGKEADFVVMEPTATPLQQLRYDNSVSLVDKLFVMMTLGD
DRSIYRTYVDGRLVYERN
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtcaggagaacacacgttaaaagcggtacgaggcagttttattgatgtcacccgtacg
gtcgataacccggaagaaattgcctctgcgctgcggtttattgaggatggtttattactc
attaaacagggaaaagtggaatggtttggcgaatgggaagacggaaagcatcaaattcct
gacaccattcgcgtgcgcgactatcgcggcaaactgatagtaccgggctttatcgataca
catatccattatccgcaaagtgaaatggtgggggcctatggtgaacaattgctggagtgg
ttgaataaacacaccttccctactgaacgtcgttatgaggatttagagtacgcccgcgag
atgtcggcgttcttcatcaagcagcttttacgtaacggaaccaccacggcgctggtgttt
ggcactgttcatccacaatccgttgatgcgctgtttgaagccgccagtcatatcaatatg
cgtatgattgccggtaaagtgatgatggaccgaaacgcaccggattatctgctcgacact
gccgaaagcagctatcaccaaagcaaagaactgattgaacgctggcacaaaaatggtcgt
ctgttgtatgcgattacgccacgcttcgcccctacctcatctcctgaacagatggcgatg
gcgcaacgcctgaaagaagaatatccggatacatgggtacatacccatctctgtgaaaac
aaagatgaaattgcctgggtgaaatcgctttatcctgaccatgatggttatcttgatgtt
taccatcagtacggcctgaccggtaaaaactgcgtctttgctcactgcgtccatctcgaa
gaaaaagagtgggatcgtctcagcgaaaccaaatccagcattgctttctgtccgacctcc
aacctttacctcggcagcggcttattcaacttgaaaaaagcatggcagaagaaagtcaaa
gtgggcatgggaacggatatcggtgccggaacaacttttaacatgctgcaaacgctgaac
gaagcctacaaggtattgcaattacaaggctatcgcctctcggcatatgaagcgttttac
ctggccacgctcggcggagcgaaatctctgggccttgacgatttgattggcaacttttta
cctggcaaagaggctgatttcgtggtgatggaacccactgccactccgctacagcagctg
cgctatgacaactctgtttctttagtcgacaaattgttcgtgatgatgacgttgggcgat
gaccgttcgatctaccgcacctacgttgatggtcgtctggtgtacgaacgcaactaa

DBGET integrated database retrieval system