KEGG   Escherichia coli NA114 (UPEC): ECNA114_2925
Entry
ECNA114_2925      CDS       T01998                                 

Gene name
ygfQ
Definition
(GenBank) hypothetical protein
  KO
K06901  adenine/guanine/hypoxanthine permease
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2925 (ygfQ)
Transporters [BR:ena02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ECNA114_2925 (ygfQ)
SSDB
Motif
Pfam: Xan_ur_permease
Other DBs
NCBI-ProteinID: AEG37762
Position
3012422..3013789
AA seq 455 aa
MSGDILQTPDAPKPQGALDNYFKITARGSTVRQEVLAGLTTFLAMVYSVIVVPGMLGKAG
FPPAAVFVATCLVAGFGSLLMGLWANLPMAIGCAISLTAFTAFSLVLGQQISVPVALGAV
FLMGVIFTAISVTGVRTWILRNLPMGIAHGTGIGIGLFLLLIAANGVGMVIKNPIEGLPV
ALGAFTSFPVMMSLLGLAVIFGLEKCRVPGGILLVIIAISIIGLIFDPAVKYHGLVAMPS
LTGEDGKSLIFSLDIMGALQPTVLPSVLALVMTAVFDATGTIRAVAGQANLLDKDNQIIN
GGKALTSDSVSSIFSGLVGAAPAAVYIESAAGTAAGGKTGLTATVVGVLFLMILFLSPLS
FLIPGYATAPALMYVGLLMLSNVSKLDFNDFIDAMAGLVCAVFIVLTCNIVTGIMLGFVT
LVVGRVFAREWQKLNIGTVIITAALVAFYAGGWAI
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctggagacatcctacaaacaccggacgcaccaaagccacagggcgcgctggataat
tattttaaaattaccgctcgtggcagtaccgttcgtcaggaagtactggctggcttaacg
acctttctggccatggtttattccgttatcgtcgttccgggaatgctgggcaaagcaggt
tttcctcccgcagctgtgtttgttgccacctgtctggtcgcgggcttcggctcgttgctg
atggggttatgggccaatttgccaatggcgattggttgcgctatttccttgacggcgttt
accgcattcagtctggtactcgggcaacaaattagcgttcctgtcgcactgggcgcagtc
tttctgatgggcgtcatcttcaccgctatttccgtaaccggtgtgcgtacctggatctta
cgtaatttgccgatggggatcgctcacggtacaggtatcggtatcggcctgtttctgctg
ctgattgctgctaacggtgtgggaatggttataaaaaacccgattgaaggcttgccagtg
gcgctcggtgcctttacctccttcccggtgatgatgagcttactggggctggcggtcatc
ttcggtctggaaaagtgccgcgtacccggcgggatcttgttggtgattattgcaatttcg
atcatcggcttaatctttgacccagcggtgaagtaccacggtctggtggcgatgccaagc
ctgactggcgaagatggtaagtctctgattttcagcctcgatattatgggcgcactccag
ccaactgtacttccgagtgtactggcattggtgatgaccgcagtgttcgacgccactggc
accatccgtgccgtcgccggtcaggcgaatttgttggataaagacaaccagatcatcaac
ggcggcaaagccctgaccagtgactcagtaagttcaatattctccggcctggtgggcgca
gcgcccgcggcggtttatatcgaatcagcggcaggaaccgccgccggggggaaaaccggt
ttaaccgcaaccgtggttggtgtgttgttcctgatgattctgtttttatcaccgttatcg
tttctgatccccggttatgccacagctcccgcactgatgtacgtgggtttgctgatgtta
agcaacgtctcgaagctggatttcaacgattttattgacgcaatggctggcctggtgtgt
gccgtgttcatcgttctgacttgtaatatcgttaccggtattatgctgggctttgtaaca
ctggtggtgggtcgcgtctttgcgcgcgaatggcaaaagctgaatattggtacggtgatc
attactgccgcactggtcgcgttttacgcgggtggttgggcaatctaa

DBGET integrated database retrieval system