KEGG   Escherichia coli NA114 (UPEC): ECNA114_2926
Entry
ECNA114_2926      CDS       T01998                                 

Gene name
ygfS
Definition
(GenBank) putative oxidoreductase
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Fer4_9 Fer4 Fer4_11 Fer4_7 Fer4_10 Fer4_6 Fer4_2 Fer4_16 Fer4_3 Fer4_8 Fer4_4 Fer4_21 Fer4_17 Fer4_13 GF_recep_IV
Other DBs
NCBI-ProteinID: AEG37763
Position
complement(3013825..3014313)
AA seq 162 aa
MKSLIIVNPADCIGCRTCEVACVVAHPSEQELNADIFLPRLKVQRLDSISAPVMCHQCEN
APCVGACPVGALTMGEQVVQANSARCIGCQSCVSACPFGMITIQSLPGDTRQQIVKCDLC
EQREEGPACVESCPTQALQLLTERELRRVRQQRIVASSENPL
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaatcgttaattatcgttaatccggctgactgtattggctgccgtacttgtgaagtg
gcctgtgtggtcgctcacccttcagaacaggagttgaatgccgatatctttttaccccgg
ctgaaggtacaacggctggatagcatcagtgcgccggtgatgtgccatcagtgtgaaaac
gccccttgtgttggcgcttgtcccgtgggggcgctgacgatgggcgagcaggtggtgcag
gcaaattctgcccgttgtattggctgtcagagttgcgtcagtgcgtgcccgtttggaatg
atcaccattcagtcattgccgggggatacccggcaacaaatcgtgaaatgcgatctctgt
gaacagcgggaagaggggccagcctgcgttgaatcttgcccgacacaggcgctgcagttg
ctgactgaaagagaactcaggcgagtccgccagcagcgtattgttgccagcagtgagaat
cctctgtga

DBGET integrated database retrieval system