KEGG   Escherichia coli NA114 (UPEC): ECNA114_2927
Entry
ECNA114_2927      CDS       T01998                                 

Gene name
ygfT
Definition
(GenBank) putative oxidoreductase
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Fer4_11 Pyr_redox Fer4_7 NAD_binding_8 Pyr_redox_3 Fer4 Fer4_6 Fer4_21 FAD_binding_3 HI0933_like FAD_oxidored Thi4 AlaDh_PNT_C Fer4_9 Fer4_10 Fer4_2 DAO 3HCDH_N Fer4_8 Fer4_4 GIDA FAD_binding_2 NAD_binding_9 2-Hacid_dh_C Fer4_16
Other DBs
NCBI-ProteinID: AEG37764
Position
complement(3014313..3016247)
AA seq 644 aa
MKGMQMNKFIAAEAAECIGCHACEIACAVAHNQENWPLSHSDFRPRIHVVGKGQAANPVA
CHHCNNAPCVTACPVNALTFQSDSVQLDEQKCIGCKRCAIACPFGVVEMVDTIAQKCDLC
NQRSSGTQACIDVCPTQALRLMDDKGLQQIKVARQRKTAAGKASSDAQPSRSAALLPVNS
RKGADKISASERKTHFGEIYCGLDPQQATYESDRCVYCAEKANCNWHCPLHNAIPDYIRL
VQEGKIIEAAELCHQTSSLPEICGRVCPQDRLCEGACTLKDHSGAVSIGNLERYITDTAL
AMGWRPDVSKVVPRSEKVAVIGAGPAGLGCADILARAGVQVDVFDRHPEIGGMLTFGIPP
FKLDKTVLSQRREIFTAMGIDFHLNCEIGRDISFNELTAEYDAVFLGVGTYGMMRADLPH
EDAPGVIQALPFLTAHTRQLMGLPESAEYPLTDVEGKRVVVLGGGDTTMDCLRTSIRLNA
ASVTCAYRRDEVSMPGSRKEVVNAREEGVEFQFNVQPQYIACDEDGRLTAVGLIRTAMGE
PGPDGRRRPRPVAGSEFELPADVLIMAFGFQAHTMPWLQGSGIKLDKWGLIQTGDVGYLP
TQTHLKKVFAGGDAVHGADLVVTAMAAGRQAARDMLTLFDTKAS
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgaaagggatgcaaatgaataagtttatcgctgctgaagctgcggaatgtataggctgc
catgcttgtgaaattgcctgtgcggtggcacataatcaagaaaactggccgctgagtcac
agtgactttcgaccgcgtatccacgttgtagggaaaggccaggctgcgaatccggtggcc
tgccatcactgcaacaatgccccttgcgttacggcttgtccggttaatgctctgactttc
cagtccgatagcgtacaactggacgagcaaaaatgtattggttgtaaaagatgcgcaatc
gcttgcccctttggcgtcgttgagatggtcgatacgattgcacagaaatgcgacctttgt
aaccagcgcagttccggcacgcaagcctgtattgacgtctgcccaacacaggcgttacgg
ctgatggacgataaagggttgcagcagataaaggtggcccgccagcgcaaaacggcagca
ggaaaagcgtcatcagacgctcagccatctcgcagtgcagcgttgctccccgttaactcg
cgtaaaggcgcagataaaatttcagcgagtgaacggaaaacccactttggcgaaatctat
tgcgggctggatccacaacaagcgacttatgagagtgaccgctgtgtttattgtgccgaa
aaagctaactgcaactggcattgtccgctgcataacgctattccggattacatccgtctg
gtacaggaaggaaagattattgaagcggcagaactttgccaccagaccagttccttaccc
gaaatctgcggcagggtatgtccacaggaccgtctttgtgaaggtgcatgtactttgaaa
gatcactctggcgcagtctctatcggtaatctggaacgctacatcaccgatactgcgctg
gcgatgggctggcgtcccgatgtcagcaaagttgttccccgtagcgaaaaagtggcggtg
attggcgctggacctgcaggattagggtgtgctgatattctggcgcgcgcgggagttcag
gttgatgtctttgatcgccatccagaaattggcggtatgctgacttttggcattcctcct
ttcaaactcgataaaacggtattaagccagcggcgagagatattcaccgcaatgggaatc
gatttccatctcaactgtgaaattggccgcgatatctctttcaacgaattaacggcggaa
tatgatgctgttttcctcggcgtggggacttacgggatgatgcgagcagatctgccgcat
gaagatgcgcctggtgtcattcaggcgttaccgttcctgaccgcccatacccgccagctc
atgggattgccggagtctgcagagtatccgctgacggatgtggaaggtaagcgagttgtg
gtattgggcggtggcgatacgacaatggattgtttgcggacttccatccgccttaatgct
gccagcgtgacctgtgcgtatcgtcgtgatgaagtcagtatgccgggttcgcgcaaagag
gtggtcaatgcccgcgaggaaggtgttgagtttcagttcaatgttcagccgcaatatatc
gcttgtgatgaagatggacgcttaacggcggtgggcctgattcgtaccgctatgggtgag
ccggggccggatggccgccgtcgtcctcgtccggttgcgggttcagagtttgaattgccc
gccgatgttctcattatggcctttggtttccaggcacataccatgccgtggttgcagggc
agcggaattaaactcgataaatggggcctgattcaaaccggcgacgtcgggtatttaccc
acccagacgcatctgaaaaaagtctttgctggtggtgatgcagttcatggcgcagatctg
gttgtcactgcaatggccgcaggaaggcaggcggcgcgcgatatgttaactctgtttgat
acgaaggcatcgtga

DBGET integrated database retrieval system