KEGG   Escherichia coli NA114 (UPEC): ECNA114_2928
Entry
ECNA114_2928      CDS       T01998                                 

Gene name
ygfU
Definition
(GenBank) putative transport protein
  KO
K24206  uric acid transporter
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2928 (ygfU)
Transporters [BR:ena02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ECNA114_2928 (ygfU)
SSDB
Motif
Pfam: Xan_ur_permease
Other DBs
NCBI-ProteinID: AEG37765
Position
3016860..3018116
AA seq 418 aa
MLISSDLFCCGIVTLLQCIGIGRFMGIRLPVIMSVTFAAVTPMIAIGMNPDIGLLGIFGA
TIAAGFITTLLAPLIGRLMPLFPPLVTGVVITSIGLSIIQVGIDWAAGGKGNPQYGNPVY
LGISFAVLIFILLITRYAKGFMSNVAVLLGIVFGFLLSWMMNEVNLSGLHDASWFAIVTP
MSFGMPIFDPVSILTMTAVLIIVFIESMGMFLALGEIVGRKLSSQDIIRGLRVDGVGTMI
GGTFNSFPHTSFSQNVGLVSVTRVHSRWVCISSGIILILFGMVPKMAVLVASIPQFVLGG
AGLVMFGMVLATGIRILSRCNYTTNRYNLYIVAISLGVGMTPTLSHDFFSKLPAVLQPLL
HSGIMLATLSAVVLNVFFNGYQHHADLVKESVSDKDLKVRTVRMWLLMRKLKKNEHGE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgctcattagctcggatctcttttgctgcgggatcgtcacattattgcaatgtatcggt
atcggccgctttatggggatccgcctgccggtgattatgtcggtgaccttcgccgctgta
acaccaatgatagccattggtatgaacccggatatcggcctgctggggatattcggtgcc
actatcgccgcgggttttatcaccacattattagcgccacttatcggtcgcttgatgcct
ttattcccgccactggttaccggtgtggtgattacttctatcgggcttagcatcattcag
gtgggtattgactgggccgccggaggtaaagggaatccgcaatatggtaatcccgtttat
ttaggtatctcctttgccgtcttaatttttatcttgctcattactcgctatgcgaaagga
tttatgtccaacgtcgccgtattactggggattgtatttggctttttactttcgtggatg
atgaatgaagtcaatttatccgggctacatgatgcttcatggtttgcgattgtcacgccg
atgtcatttggtatgccgattttcgatcccgtttccattttgaccatgaccgcagtactc
atcatcgtatttattgagtcaatggggatgttcctggcactgggtgaaatagtcggtcgc
aaactctcttcccaggacattattcgtgggttacgcgtagatggggtcgggacaatgatt
ggaggcacgtttaacagcttcccacatacgtcattttcgcagaacgtcgggctggtcagc
gtgacgcgcgtccacagccgctgggtgtgtatttcttcgggaattatattaatcctgttt
ggcatggtgcccaaaatggcggtgctggtcgcctccattccgcaatttgtgctgggcggc
gcggggctggtgatgttcggcatggtactggcgacagggattcgaattctgtcgcgctgt
aactacaccactaaccgttacaacctctatattgtggcgatcagtctcggtgttggcatg
acgccaacgctctctcacgatttcttttctaagttaccggccgtactgcaaccgttgctg
catagcggcattatgctcgcaacccttagcgccgttgtgctgaacgtcttctttaatggc
taccagcatcatgctgacctggtgaaggaatccgtctctgataaagatttaaaagtcagg
acagtacgtatgtggcttctgatgcgcaagctgaagaaaaatgagcatggagaataa

DBGET integrated database retrieval system