KEGG   Escherichia coli NA114 (UPEC): ECNA114_2929
Entry
ECNA114_2929      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Other DBs
NCBI-ProteinID: AEG37766
Position
3018118..3018243
AA seq 41 aa
MNLLMRAIFSLLLLFTLSIPVISDCVAMAIESRFKYMMLLF
NT seq 126 nt   +upstreamnt  +downstreamnt
atgaatcttttaatgcgcgctatattcagtctgctgttgctttttactctctctattcct
gtcatttctgattgtgttgcaatggccattgaaagtcgcttcaaatatatgatgctgctt
ttttaa

DBGET integrated database retrieval system