KEGG   Escherichia coli NA114 (UPEC): ECNA114_2930
Entry
ECNA114_2930      CDS       T01998                                 

Definition
(GenBank) Isopentenyl-diphosphate delta-isomerase
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00900  Terpenoid backbone biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
Module
ena_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
ena_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECNA114_2930
Enzymes [BR:ena01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     ECNA114_2930
SSDB
Motif
Pfam: NUDIX Tyr-DNA_phospho
Other DBs
NCBI-ProteinID: AEG37767
Structure
PDB: 

Position
3018366..3018914
AA seq 182 aa
MQTEHVILLNAQGVPTGTLEKYAAHTADTLLHLAFSSWLFNAKGQLLVTRRALSKKAWPG
VWTNSVCGHPQLGESNEEAVIRRCRYELGVEITPPESIYPDFRYRATDPNGIVENEVCPV
FAARTTSALQINDDEVMDYQWCDLAAVLRGIDATPWAFSPWMVMQATNREARKRLSAFTQ
LK
NT seq 549 nt   +upstreamnt  +downstreamnt
atgcaaacggaacacgtcattttattgaatgcacagggagttcccacgggtacgctggaa
aagtatgccgcacacacggcagacaccctcttacatctcgcgttttccagttggctgttt
aatgccaaagggcaattattagttacccgccgcgcccttagcaaaaaagcatggcctggc
gtgtggactaactcggtttgtgggcacccacaactgggagaaagcaacgaagaggcggtg
atccgccgttgccgttatgagcttggcgtagaaattacgcctcctgaatctatctatcct
gactttcgctaccgcgccaccgatccgaatggcattgtggaaaatgaagtgtgtccggta
tttgccgcacgcacgaccagtgcgttacagatcaacgatgatgaagtgatggattatcaa
tggtgtgatttagcagcggttttacgcggtattgatgctacgccgtgggcgttcagtccg
tggatggtgatgcaggcgacaaatcgcgaagccagaaaacgattatctgcatttacccaa
cttaaataa

DBGET integrated database retrieval system