KEGG   Escherichia coli NA114 (UPEC): ECNA114_2931
Entry
ECNA114_2931      CDS       T01998                                 

Gene name
lysS1
Definition
(GenBank) Lysyl-tRNA synthetase
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ena00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECNA114_2931 (lysS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ena01007]
    ECNA114_2931 (lysS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ena03016]
    ECNA114_2931 (lysS1)
Enzymes [BR:ena01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     ECNA114_2931 (lysS1)
Amino acid related enzymes [BR:ena01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   ECNA114_2931 (lysS1)
Transfer RNA biogenesis [BR:ena03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ECNA114_2931 (lysS1)
 Prokaryotic type
   Other AARSs
    ECNA114_2931 (lysS1)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Other DBs
NCBI-ProteinID: AEG37768
Structure
PDB: 
1BBU 1BBW 1KRS 1KRT

Position
complement(3018957..3020474)
AA seq 505 aa
MSEQHAQGADAVVDLNNELKTRREKLANLREQGIAFPNDFRRDHTSDQLHAEFDGKENEE
LEALNIEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDDLPEGVYNEQFKKWDLGD
ILGAKGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGLQDQEARYRQRYLDLISNDES
RNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHHNALDLDMYLRIAP
ELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRT
LAQDILGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGI
HVEKSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGG
REIGNGFSELNDAEDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHGLPPTAGLGIGID
RMVMLFTNSHTIRDVILFPAMRPVK
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtctgaacaacacgcacagggcgctgacgcggtagtcgatcttaacaatgaactgaaa
acgcgtcgtgagaagctggcgaacctgcgtgagcaggggattgccttcccgaacgatttc
cgtcgcgatcatacctctgaccaattgcacgcagaattcgacggtaaagagaacgaagaa
ctggaagcgctgaacatcgaagtcgccgttgctggccgcatgatgacccgtcgtattatg
ggtaaagcgtctttcgttaccctgcaggacgttggcggtcgcattcagttgtacgttgcc
cgtgacgatctgccggaaggcgtttacaacgagcagttcaaaaaatgggacctcggcgat
atcctcggcgcgaaaggtaaactgttcaaaaccaaaaccggcgaactgtctatccactgt
accgagctgcgtctgctgaccaaagcactgcgtccgctgccggataaattccacggcttg
caggatcaggaagcgcgctatcgtcagcgttatttggatctcatctctaacgatgaatcc
cgcaacacctttaaagtgcgctcgcagatcctctctggtattcgccagttcatggtgaac
cgcggctttatggaagttgaaacgccgatgatgcaggtgatccctggcggtgccgctgcg
cgtccgtttatcactcaccataacgcgctggatctcgacatgtacctgcgtatcgcgccg
gaactgtacctcaagcgtctggtggtcggtggcttcgagcgtgtattcgaaatcaaccgt
aacttccgtaacgaaggtatttccgtacgtcataacccagagttcaccatgatggaactc
tatatggcttacgcagattacaaagatctgatcgagctgaccgaatcgctgttccgtact
ctggcacaggatattctcggtaagacggaagtgacctacggcgacgtaacgctggacttc
ggtaaaccgttcgaaaaactgaccatgcgtgaagcgatcaagaaatatcgcccggaaacc
gacatggcggatctggacaacttcgactctgcgaaagcgattgctgaatctatcggcatc
cacgttgaaaagagctggggtctgggccgtatcgttaccgagatcttcgaagaagtggca
gaagctcatctgatccagccgaccttcattactgaatatccggcagaagtttctcctctg
gcgcgtcgtaacgacgttaacccggaaatcacagaccgctttgagttcttcattggtggg
cgtgaaatcggtaacggctttagcgaactgaatgacgcggaagatcaggcgcagcgcttc
ctggatcaggttgccgcgaaagatgcaggtgacgacgaagcgatgttctacgacgaagat
tatgtcaccgcactggaacatggcttaccgccgacagccggtctgggaattggtatcgac
cgtatggtgatgctgttcaccaacagccataccatccgcgacgttattctgttcccggcg
atgcgtccggtaaaataa

DBGET integrated database retrieval system