KEGG   Escherichia coli NA114 (UPEC): ECNA114_2932
Entry
ECNA114_2932      CDS       T01998                                 

Gene name
prfB
Definition
(GenBank) Peptide chain release factor 2
  KO
K02836  peptide chain release factor 2
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ena03012]
    ECNA114_2932 (prfB)
Translation factors [BR:ena03012]
 Prokaryotic type
  Release factors
   ECNA114_2932 (prfB)
SSDB
Motif
Pfam: PCRF RF-1
Other DBs
NCBI-ProteinID: AEG37769
Structure
PDB: 
1GQE 6C4H 5U4J 1MI6 1ML5

Position
complement(3020484..3021365)
AA seq 293 aa
MKQGLEDVSGLLELAVEADDEETFNEAVAELDALEEKLAQLEFRRMFSGEYDSADCYLDI
QAGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGIKSVTIKISGDYAYGWL
RTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQ
HVNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYELEMQKKNAEKQAMED
NKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSLDQFIEASLKAGL
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaaacaggggctggaagatgtttctggtctgctggaactggctgtagaagctgacgac
gaagaaacctttaacgaagccgttgctgaactcgacgccctggaagaaaaactggcgcag
cttgagttccgccgtatgttctctggcgaatatgacagcgccgactgctacctcgatatt
caggcggggtctggcggtacggaagcacaggactgggcgagcatgcttgagcgtatgtat
ctgcgctgggctgaatcgcgtggtttcaaaactgaaatcatcgaagagtcggaaggtgaa
gtggcgggtattaaatccgtgacgatcaaaatctccggcgattacgcttatggctggctg
cgtacagaaaccggcgttcaccgcctggtgcgtaagagcccgtttgactccggcggtcgt
cgccacacgtcgttcagctccgcgtttgtttacccggaagttgatgatgatatcgatatc
gaaatcaatccagcggatctgcgcatcgacgtttatcgcgcatccggcgcgggcggtcag
cacgttaaccgtaccgaatctgcggtgcgtattactcacatcccaaccgggatcgtgacc
caatgccagaacgaccgttcccagcacaagaacaaagaccaggccatgaagcagatgaaa
gcgaagctttatgaactggagatgcagaagaaaaatgccgagaaacaggcgatggaagat
aacaaatccgacatcggctggggcagccagattcgttcttatgtccttgatgactcccgc
attaaagatctgcgtaccggggtagaaactcgcaacacgcaggccgtgctggacggcagc
ctggatcaatttatcgaagcaagtttgaaagcagggttatga

DBGET integrated database retrieval system