KEGG   Escherichia coli NA114 (UPEC): ECNA114_2934
Entry
ECNA114_2934      CDS       T01998                                 

Gene name
recJ
Definition
(GenBank) Single-stranded-DNA-specific exonuclease
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena03410  Base excision repair
ena03430  Mismatch repair
ena03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ena00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    ECNA114_2934 (recJ)
   03430 Mismatch repair
    ECNA114_2934 (recJ)
   03440 Homologous recombination
    ECNA114_2934 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ena03400]
    ECNA114_2934 (recJ)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     ECNA114_2934 (recJ)
DNA repair and recombination proteins [BR:ena03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     ECNA114_2934 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ECNA114_2934 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ECNA114_2934 (recJ)
SSDB
Motif
Pfam: DHHA1 RecJ_OB DHH PEP-utilizers
Other DBs
NCBI-ProteinID: AEG37771
Position
complement(3021673..3023406)
AA seq 577 aa
MKQQIQLRRREVDETADLPAELPPLLRRLYASRGVRSAQELERSVKGMLPWQQLSGVEKA
VEILYNAFREGTRIIVVGDFDADGATSTALSVLAMRSLGCSNIDYLVPNRFEDGYGLSPE
VVDQAHARGAQLIVTVDNGISSHAGVEHARSLGIPVIVTDHHLPGDTLPAAEAIINPNLR
DCNFPSKSLAGVGVAFYLMLALRTFLRDQGWFDERGIAIPNLAELLDLVALGTVADVVPL
DANNRILTWQGMSRIRAGKCRPGIKALLEVANRDPQKLAASDLGFALGPRLNAAGRLDDM
SVGVALLLCDNIGEARVLANELDALNQTRKEIEQGMQVEALTLCEKLERSRDTLPGGLAM
YHPEWHQGVVGILASRIKERFHRPVIAFAPAGDGTLKGSGRSIQGLHMRDALERLDTLYP
GMMLKFGGHAMAAGLSLEEEKFELFQQRFGELVTEWLDPSLLQGEVVSDGPLSPAEMTME
VAQLLRDAGPWGQMFPEPLFDGHFRLLQQRLVGERHLKVMVEPVGGGPLLDGIAFNVDTA
LWPDNGVHEVQLAYKLDINEFRGNRSLQIIIDNIWPI
NT seq 1734 nt   +upstreamnt  +downstreamnt
gtgaaacaacagatacaacttcgtcgccgtgaagtcgatgaaacggccgacttgcccgct
gaattgcctcccttgctgcgccgtttatatgccagccggggtgtgcgtagcgcgcaggaa
ctggaacgcagtgttaaaggcatgctgccctggcagcaactgagcggcgtcgaaaaggcc
gttgagatcctttacaacgcttttcgcgaaggaacgcggattattgtggtcggtgatttc
gacgccgacggtgccaccagcacggctctaagcgtgctggcgatgcgctcgcttggttgc
agcaatatcgactacctggttccaaaccgtttcgaagacggttacggcttaagcccggaa
gtagtcgatcaggctcatgcccgtggcgcgcagttaattgtcacggtggataacggtatt
tcctcccatgcgggggttgaacacgctcgttcgttgggcattccggttattgttaccgat
caccatttgccaggcgacacattacccgcagcggaagcgatcattaaccctaacttgcgc
gactgtaatttcccgtcgaaatcactggcgggcgttggcgtggcgttttatctgatgctg
gcgctgcgcacctttttgcgcgatcagggctggtttgatgagcgcggcatcgcaattcct
aatctggcagaactgctggatctggtagcgttggggacagtggcggacgtcgtgccgctg
gacgctaataatcgcattctgacctggcaggggatgagtcgcatccgtgccggaaagtgc
cgtccggggattaaagcgttgctggaagtggccaatcgcgatccacaaaaactcgccgcc
agcgatttaggttttgcgctggggccacgtctcaatgctgccgggcgactggacgatatg
tccgttggcgtggcgctgttgctgtgcgacaacatcggcgaagcgcgcgtgctggcaaat
gaactcgatgcgctaaaccagacgcgaaaagagatcgaacagggaatgcaagttgaagcc
ctgaccttgtgcgagaaactggagcgcagccgcgacacgctacccggcgggctggcaatg
tatcaccccgaatggcatcagggcgttgtcggtattctggcttcgcgcatcaaagagcgt
tttcatcgtccggttatcgcctttgcgccagctggtgatggtacgctgaaaggttccggt
cgctccattcaggggctgcatatgcgtgatgcgctggagcggctagacacgctttacccc
ggcatgatgctcaagtttggcggtcatgcgatggcggcgggtttgtcgctggaagaggag
aaattcgaactctttcaacaacggtttggcgaactggttactgagtggctggacccttcg
ctattgcaaggcgaagtggtgtcggacggtccgttaagtccggccgaaatgaccatggaa
gtggcgcagctgttgcgcgatgctggcccgtgggggcagatgttcccggagccgctgttt
gatggtcatttccgtctgctgcaacagcggctggtgggcgaacgtcatttgaaagtcatg
gtcgaaccggtcggcggcggtccactgctggacgggattgcttttaatgtcgataccgcc
ctctggccggataacggcgtgcacgaagtgcaactggcttacaagctcgatatcaacgag
tttcgcggcaaccgcagcctgcaaattatcatcgacaatatctggccaatttag

DBGET integrated database retrieval system