KEGG   Escherichia coli NA114 (UPEC): ECNA114_2936
Entry
ECNA114_2936      CDS       T01998                                 

Gene name
xerD
Definition
(GenBank) Integrase/recombinase
  KO
K04763  integrase/recombinase XerD
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ena03036]
    ECNA114_2936 (xerD)
Chromosome and associated proteins [BR:ena03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ECNA114_2936 (xerD)
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4 HTH_52
Other DBs
NCBI-ProteinID: AEG37773
Structure
PDB: 
1A0P

Position
complement(3024147..3025043)
AA seq 298 aa
MKQDLARIEQFLDALWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLA
ERLEGGYKATSSARLLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVER
LLQAPLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVP
LGEEAVYWLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEK
LSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA
NT seq 897 nt   +upstreamnt  +downstreamnt
gtgaaacaggatctggcacgcatcgagcagtttcttgatgctctgtggctggaaaaaaat
ctggctgaaaatacgttgaacgcttaccgtcgcgatctgtcaatgatggtggagtggttg
catcaccgcgggttgacgctggcgacggcgcaaagtgacgatttgcaggcattactggca
gaacggctggagggcgggtataaagccaccagctcagcgcgtttgctgagtgcagtgcgc
cgattgttccagtatctttatcgcgaaaagtttcgtgaagatgatcccagtgcgcatctc
gcttcaccgaaattgccccagcgtttgccaaaagatttaagcgaagcgcaggtcgaacgt
ttattacaggcaccattaattgatcagccactggagctacgcgataaagccatgcttgaa
gtgttgtatgctaccggactgcgtgtctctgaactggtcgggctgacaatgagtgatatc
agcctgcgtcagggcgtggtgcgggtcattggtaaaggcaacaaagagcgcctggtgccg
ttaggtgaagaggcggtttactggctggaaacctatctggaacatgggcgtccgtggctg
ttgaatggtgtgtcaattgacgtgttgtttcccagccagcgtgcgcagcagatgacgcga
cagaccttctggcaccgcattaaacattatgccgtgctggcgggtatcgacagcgaaaag
ctgtcaccgcatgtgttgcgtcacgcttttgccactcacttattaaatcatggtgcggat
ttacgcgtggtgcagatgctactgggccacagcgatctctccaccacgcaaatttatacg
catgtcgctaccgagcgtctgcgacaacttcatcaacagcatcacccgcgggcgtga

DBGET integrated database retrieval system