KEGG   Escherichia coli NA114 (UPEC): ECNA114_2937
Entry
ECNA114_2937      CDS       T01998                                 

Gene name
fldB
Definition
(GenBank) Flavodoxin 2
  KO
K03840  flavodoxin II
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    ECNA114_2937 (fldB)
SSDB
Motif
Pfam: Flavodoxin_1 Flavodoxin_3
Other DBs
NCBI-ProteinID: AEG37774
Structure
PDB: 
2MT9 2MTB

Position
3025155..3025676
AA seq 173 aa
MNMGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQYDVLILGIPTWDFGE
IQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGMLHDKLSTKGVKFVGYWP
TEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSWCEQILNEMAEHYA
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaatatgggtcttttttacggttccagcacctgttacaccgaaatggcggcagaaaaa
atccgcgatattatcggcccagaactggtgaccttacataacctcaaggacgactccccg
aaattaatggagcagtacgatgtgctcattctgggtatcccgacctgggattttggcgaa
atccaggaagactgggaagccgtctgggatcagctcgacgacctgaacctcgaaggtaaa
attgttgcgctgtatgggcttggcgatcaactgggatacggcgagtggttcctcgatgcg
ctcggtatgctgcatgacaaactctcgaccaaaggcgtgaagttcgtcggctactggcca
acggaaggatatgaatttaccagtccgaaaccggtgattgctgacgggcaactgttcgtg
ggtctggcgctggatgaaactaaccagtatgaccttagcgacgagcgtattcaaagctgg
tgcgagcaaatcctcaacgaaatggcagagcattacgcctga

DBGET integrated database retrieval system